Clone IP01143 Report

Search the DGRC for IP01143

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:11
Well:43
Vector:pOT2
Associated Gene/Transcripte(y)2-RA
Protein status:IP01143.pep: gold
Preliminary Size:481
Sequenced Size:468

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15191 2005-01-01 Successful iPCR screen
e(y)2 2008-04-29 Release 5.5 accounting
e(y)2 2008-08-15 Release 5.9 accounting
e(y)2 2008-12-18 5.12 accounting

Clone Sequence Records

IP01143.complete Sequence

468 bp (468 high quality bases) assembled on 2005-08-25

GenBank Submission: BT022196

> IP01143.complete
AAAAGCAAAAAAACAGACGCTGCGAAATCGACAAGGACTCGAAAAAGGAA
ACTTGGTAATTTGCAAGACTTAGATACGCGACACAAGGATGAGCACTTCC
GGCGCAGTTGATCAGTACACGGTGCTAACCGGCGACCGTTCCAAGATCAA
GGATTTGCTCTGCAGCCGCCTTACGGAATGTGGCTGGCGGGACGAGGTGC
GTCTGATGTGCCGCAACATCCTGATGGAGAAGGGCACCAACAACAGCTTC
ACCGTAGAGCAGCTGATCGCCGAGGTAACACCCAAGGCACGCACCCTGGT
CCCGGATGCCGTCAAAAAGGAGCTGCTTATGAAGATACGCACCATTCTCA
CGGAAATTGAGGAGGAACCCGATGAGCCAGAGGACGAATCCTAACTTTAA
CTCAGCGTCATTGGATTTGTATATTAATAAAGTTTATTTGTACGATTTTA
AAAAAAAAAAAAAAAAAA

IP01143.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)2-RA 481 e(y)2-RA 30..479 1..450 2250 100 Plus
CG11696-RA 2346 CG11696-RA 2265..2346 450..369 410 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:19:04
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11467317..11467765 449..1 2245 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:30:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:19:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11576117..11576566 450..1 2250 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11584215..11584664 450..1 2250 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:19:03 has no hits.

IP01143.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:19:46 Download gff for IP01143.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11467317..11467765 1..449 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:14:12 Download gff for IP01143.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2-RA 1..306 89..394 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:45:26 Download gff for IP01143.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2-RA 1..306 89..394 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:08:11 Download gff for IP01143.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2-RA 1..306 89..394 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:26:24 Download gff for IP01143.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2-RA 1..306 89..394 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:25:31 Download gff for IP01143.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2-RA 1..306 89..394 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:54:09 Download gff for IP01143.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2-RA 30..478 1..449 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:45:26 Download gff for IP01143.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2-RA 30..478 1..449 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:08:11 Download gff for IP01143.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2-RA 55..503 1..449 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:26:24 Download gff for IP01143.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2-RA 30..478 1..449 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:25:31 Download gff for IP01143.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2-RA 55..503 1..449 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:19:46 Download gff for IP01143.complete
Subject Subject Range Query Range Percent Splice Strand
X 11576118..11576566 1..449 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:19:46 Download gff for IP01143.complete
Subject Subject Range Query Range Percent Splice Strand
X 11576118..11576566 1..449 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:19:46 Download gff for IP01143.complete
Subject Subject Range Query Range Percent Splice Strand
X 11576118..11576566 1..449 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:08:11 Download gff for IP01143.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11470151..11470599 1..449 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:59:23 Download gff for IP01143.complete
Subject Subject Range Query Range Percent Splice Strand
X 11584216..11584664 1..449 100   Minus

IP01143.hyp Sequence

Translation from 88 to 393

> IP01143.hyp
MSTSGAVDQYTVLTGDRSKIKDLLCSRLTECGWRDEVRLMCRNILMEKGT
NNSFTVEQLIAEVTPKARTLVPDAVKKELLMKIRTILTEIEEEPDEPEDE
S*

IP01143.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)2-PA 101 CG15191-PA 1..101 1..101 514 100 Plus
e(y)2b-PB 95 CG14612-PB 18..93 11..87 181 41.6 Plus
e(y)2b-PA 95 CG14612-PA 18..93 11..87 181 41.6 Plus

IP01143.pep Sequence

Translation from 88 to 393

> IP01143.pep
MSTSGAVDQYTVLTGDRSKIKDLLCSRLTECGWRDEVRLMCRNILMEKGT
NNSFTVEQLIAEVTPKARTLVPDAVKKELLMKIRTILTEIEEEPDEPEDE
S*

IP01143.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20364-PA 100 GF20364-PA 1..99 1..99 418 81.8 Plus
Dana\GF17650-PA 102 GF17650-PA 23..93 16..87 173 44.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18848-PA 101 GG18848-PA 1..88 1..88 436 94.3 Plus
Dere\GG13819-PA 101 GG13819-PA 14..93 7..87 189 46.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:40:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11892-PA 94 GH11892-PA 1..93 1..93 379 75.3 Plus
Dgri\GH19002-PA 102 GH19002-PA 13..95 4..87 176 41.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:01
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)2-PA 101 CG15191-PA 1..101 1..101 514 100 Plus
e(y)2b-PB 95 CG14612-PB 18..93 11..87 181 41.6 Plus
e(y)2b-PA 95 CG14612-PA 18..93 11..87 181 41.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:40:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15902-PA 94 GI15902-PA 1..91 1..91 398 82.4 Plus
Dmoj\GI23058-PA 112 GI23058-PA 21..93 14..87 149 36.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26889-PA 100 GL26889-PA 1..99 1..99 365 69.7 Plus
Dper\GL12417-PA 102 GL12417-PA 27..95 20..87 153 43.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\e(y)2-PA 100 GA13559-PA 1..99 1..99 359 68.7 Plus
Dpse\e(y)2b-PA 102 GA13111-PA 27..95 20..87 160 46.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13063-PA 101 GM13063-PA 1..88 1..88 440 96.6 Plus
Dsec\GM10932-PA 99 GM10932-PA 18..93 11..87 178 41.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:40:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24533-PA 101 GD24533-PA 1..88 1..88 433 95.5 Plus
Dsim\GD19911-PA 99 GD19911-PA 18..93 11..87 181 42.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:40:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16811-PA 95 GJ16811-PA 1..94 1..93 387 79.8 Plus
Dvir\GJ24569-PA 105 GJ24569-PA 13..95 4..87 204 48.8 Plus
Dvir\GJ18481-PA 111 GJ18481-PA 29..95 20..87 168 47.1 Plus
Dvir\GJ18485-PA 104 GJ18485-PA 29..101 20..101 167 45.1 Plus
Dvir\GJ18482-PA 100 GJ18482-PA 11..95 2..87 163 39.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16303-PA 119 GK16303-PA 1..99 1..93 390 78.8 Plus
Dwil\GK15430-PA 109 GK15430-PA 1..74 7..74 197 59.5 Plus
Dwil\GK11231-PA 102 GK11231-PA 14..102 7..96 170 37.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17290-PA 101 GE17290-PA 1..88 1..88 436 95.5 Plus
Dyak\GE24901-PA 102 GE24901-PA 14..93 7..87 190 45.7 Plus
Dyak\GE14777-PA 102 GE14777-PA 14..93 7..87 190 45.7 Plus