Clone IP01184 Report

Search the DGRC for IP01184

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:11
Well:84
Vector:pOT2
Associated Gene/TranscriptCG15710-RA
Protein status:IP01184.pep: gold
Preliminary Size:798
Sequenced Size:932

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15710 2005-01-01 Successful iPCR screen
CG15710 2008-04-29 Release 5.5 accounting
CG15710 2008-08-15 Release 5.9 accounting
CG15710 2008-12-18 5.12 accounting

Clone Sequence Records

IP01184.complete Sequence

932 bp (932 high quality bases) assembled on 2005-08-25

GenBank Submission: BT022189

> IP01184.complete
CGACTTTCTCACTTTCTTCGTACGCTTCTTACTGGCGAAACACAAGAGCC
CACAAAGGATTATGACAAGTGCTGGCAACTGGATTTCCGAGGAGCTGGAA
CCAGCTACTCTACTGTCGATTCAGGAGGATAATGGTATTGTTACCAAGGT
GTACGTGGCGCCCTGTTTGCAGCCGATAAAAGAGGAGAAAGTTTTCCTGG
AGGACAACACGCAACGCTTCCACTGTCCGCTTTGCTCTAATGTGATTCGC
ACGGCCGGTGCCTACAAGGTCCATCTGATGGCCTGCCAAAGACGCTTGGC
ACGCATGATGAAGGATGTGCCGGACGTGTCCCAGCATCAGTGCAACATTT
GCAAGAAAATCTTCTCCTCGGTGGATGCCCTGATCGGCCACAGGCTCCTG
CATGGAAGCCCATCAATGAATCGCACCTGTGCATCCTGCCATGTCAAGTT
CGGGACGGATCTGGAGTATCGCACCCATTTGGAGAGCCATCTGATACCGT
GCGAGTCCACGGATGAATCCTACGAAGGGGCGTACACCATCACCAAGACC
TTCAATTGCGTCTTTTGTCGCACGGAGTTCAAGGCCTGCTTTAAGCCTGG
CCAAGTGACCCGTCGATACGCGTGCGACGCATGTATCGTAAGGCTGAAGG
CCCAGGAGGAGGAGAAAAAGATCTTAGGGAAGAGAAGGCCCGAATTAATC
TGTGATCGTTGTGGGAAAAAGTACAAATATGAGGGTTTCCTTCACCGTCA
TCTGAAAACTTGCCAGATGCCGGATAAATGCAAAAGAAAGCGTGAGATTG
AAATCACCGAGGTCAGCGAGGTAACATTTACAGAAGTTGTGCAAAGTTTT
AATAATTGATTATACAAATTCGCACATTTTAATTTTAAATTAAATAAATA
TATTTTTTAATTGTAAAAAAAAAAAAAAAAAA

IP01184.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:30:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG15710-RA 914 CG15710-RA 1..914 1..914 4570 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:43:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12234914..12235827 914..1 4555 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:30:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16347612..16348527 916..1 4580 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:21:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16348811..16349726 916..1 4580 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:43:46 has no hits.

IP01184.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:44:58 Download gff for IP01184.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12234954..12235827 1..874 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:14:17 Download gff for IP01184.complete
Subject Subject Range Query Range Percent Splice Strand
CG15710-RA 1..798 62..859 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:53:48 Download gff for IP01184.complete
Subject Subject Range Query Range Percent Splice Strand
CG15710-RA 1..798 62..859 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:10:44 Download gff for IP01184.complete
Subject Subject Range Query Range Percent Splice Strand
CG15710-RA 1..798 62..859 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:34:31 Download gff for IP01184.complete
Subject Subject Range Query Range Percent Splice Strand
CG15710-RA 1..798 62..859 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:42:18 Download gff for IP01184.complete
Subject Subject Range Query Range Percent Splice Strand
CG15710-RA 1..798 62..859 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:29:01 Download gff for IP01184.complete
Subject Subject Range Query Range Percent Splice Strand
CG15710-RA 1..798 62..859 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:53:48 Download gff for IP01184.complete
Subject Subject Range Query Range Percent Splice Strand
CG15710-RA 1..914 1..914 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:10:44 Download gff for IP01184.complete
Subject Subject Range Query Range Percent Splice Strand
CG15710-RA 1..914 1..914 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:34:31 Download gff for IP01184.complete
Subject Subject Range Query Range Percent Splice Strand
CG15710-RA 1..798 62..859 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:42:18 Download gff for IP01184.complete
Subject Subject Range Query Range Percent Splice Strand
CG15710-RA 1..914 1..914 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:44:58 Download gff for IP01184.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16347614..16348527 1..914 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:44:58 Download gff for IP01184.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16347614..16348527 1..914 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:44:58 Download gff for IP01184.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16347614..16348527 1..914 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:10:44 Download gff for IP01184.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12235119..12236032 1..914 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:13:04 Download gff for IP01184.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16348813..16349726 1..914 100   Minus

IP01184.hyp Sequence

Translation from 0 to 858

> IP01184.hyp
DFLTFFVRFLLAKHKSPQRIMTSAGNWISEELEPATLLSIQEDNGIVTKV
YVAPCLQPIKEEKVFLEDNTQRFHCPLCSNVIRTAGAYKVHLMACQRRLA
RMMKDVPDVSQHQCNICKKIFSSVDALIGHRLLHGSPSMNRTCASCHVKF
GTDLEYRTHLESHLIPCESTDESYEGAYTITKTFNCVFCRTEFKACFKPG
QVTRRYACDACIVRLKAQEEEKKILGKRRPELICDRCGKKYKYEGFLHRH
LKTCQMPDKCKRKREIEITEVSEVTFTEVVQSFNN*

IP01184.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG15710-PA 265 CG15710-PA 1..265 21..285 1430 100 Plus
CG3847-PA 380 CG3847-PA 186..380 73..267 321 35.3 Plus

IP01184.pep Sequence

Translation from 61 to 858

> IP01184.pep
MTSAGNWISEELEPATLLSIQEDNGIVTKVYVAPCLQPIKEEKVFLEDNT
QRFHCPLCSNVIRTAGAYKVHLMACQRRLARMMKDVPDVSQHQCNICKKI
FSSVDALIGHRLLHGSPSMNRTCASCHVKFGTDLEYRTHLESHLIPCEST
DESYEGAYTITKTFNCVFCRTEFKACFKPGQVTRRYACDACIVRLKAQEE
EKKILGKRRPELICDRCGKKYKYEGFLHRHLKTCQMPDKCKRKREIEITE
VSEVTFTEVVQSFNN*

IP01184.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:51:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11266-PA 258 GF11266-PA 1..257 1..250 515 44 Plus
Dana\GF19351-PA 387 GF19351-PA 193..386 53..246 299 35 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:51:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22270-PA 259 GG22270-PA 1..259 1..252 952 71 Plus
Dere\GG19588-PA 391 GG19588-PA 197..391 53..247 294 34.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:51:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24059-PA 388 GH24059-PA 194..388 53..247 297 36.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG15710-PA 265 CG15710-PA 1..265 1..265 1430 100 Plus
CG3847-PA 380 CG3847-PA 186..380 53..247 321 35.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:51:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15187-PA 219 GI15187-PA 25..219 53..247 292 35.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:51:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26853-PA 375 GL26853-PA 178..375 50..247 305 35.6 Plus
Dper\GL11346-PA 203 GL11346-PA 2..201 11..243 240 30.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:51:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22638-PA 375 GA22638-PA 178..375 50..247 305 35.6 Plus
Dpse\GA24693-PA 203 GA24693-PA 2..201 11..243 239 30.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:51:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20060-PA 274 GM20060-PA 24..274 1..252 1095 81.3 Plus
Dsec\GM12485-PA 385 GM12485-PA 191..384 53..246 297 35.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:51:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25542-PA 259 GD25542-PA 24..241 1..219 915 79 Plus
Dsim\GD24756-PA 358 GD24756-PA 187..357 53..246 214 32 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:51:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17068-PA 456 GJ17068-PA 179..373 53..247 302 35.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:51:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19886-PA 397 GK19886-PA 203..396 53..246 293 33.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:51:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14065-PA 253 GE14065-PA 1..253 1..252 970 72.3 Plus
Dyak\GE16749-PA 383 GE16749-PA 189..383 53..247 295 34.8 Plus