Clone IP01195 Report

Search the DGRC for IP01195

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:11
Well:95
Vector:pOT2
Associated Gene/TranscriptsisA-RA
Protein status:IP01195.pep: gold
Preliminary Size:768
Sequenced Size:770

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1641 2005-01-01 Successful iPCR screen
sisA 2008-04-29 Release 5.5 accounting
sisA 2008-08-15 Release 5.9 accounting
sisA 2008-12-18 5.12 accounting

Clone Sequence Records

IP01195.complete Sequence

770 bp (770 high quality bases) assembled on 2006-03-09

GenBank Submission: BT022187

> IP01195.complete
AAATCTCGACGAGAGCAGTCACAGACCACGTCACACATCGAAAAAAATCA
CCATGGAACGGAGTCATCTTTACTTGCCCACTCTGAGCTACGCGGCCATG
GGTCACGTATACGCACCGTATCGCGGAAGCAGTTCACCCGCACTATCGAC
AGCATCGTCAACATCATCGAAGCCGGAGCAGATCGAGGAGCTGGTGTCCC
AGCAGCTGCATCATCTCAAAATGCACTACGCCGACGAGGAGCAACGCTAC
GTAGACCAGATGCTCCTGGAGAATCCCATTGTTGTGGAGCGCCGTGCACC
GCCGCCGCTGAAAACGGAGCTTGCTATGGATTGCCGCGGATCGGGTTCCG
GATCAGGTTCCGGTTCTGGTTCGGATGTCAAGGATGCCCAGCGTCAGAGG
GCCGAGTCGTGCCGCAAATCCCGCTACAACAACAAGATCAAGAAGGCCAA
GCTGCGCTTCCGGCACAAATTCGTCAGCGGGCAGCTGAAGAAGAGCGCCG
TCATGTTGGACACGATGCGGGATGTGATTGCCCAGGCGGAGAGGCAGCTG
CTCGAGCGGGGATATCCCGCCGCCACACTCGAGCGGATGCGGGCCACTTT
CGGCCTGGAAATGGAGCAGTGATATCATAGTGTAGCTATGTGTCGCAGGA
ACGGATCCCTGACTAGTCCAGCATTAGCCATACCACTTTTTTTTTTGTTG
ACTATATCTAGTATTTATCTAAGCATATTATTAAATTTTTAAATAAAATT
AAGAATCATATTGAAAAAAA

IP01195.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
sisA-RA 772 sisA-RA 5..772 1..767 3800 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11212734..11213501 763..1 3700 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:30:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11321575..11322342 767..1 3790 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11329673..11330440 767..1 3800 99.8 Minus
Blast to na_te.dros performed on 2019-03-16 00:26:43 has no hits.

IP01195.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:27:43 Download gff for IP01195.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11212779..11213501 1..718 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:14:19 Download gff for IP01195.complete
Subject Subject Range Query Range Percent Splice Strand
sisA-RA 1..570 53..622 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:51 Download gff for IP01195.complete
Subject Subject Range Query Range Percent Splice Strand
sisA-RA 1..570 53..622 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:12:10 Download gff for IP01195.complete
Subject Subject Range Query Range Percent Splice Strand
sisA-RA 1..570 53..622 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:16 Download gff for IP01195.complete
Subject Subject Range Query Range Percent Splice Strand
sisA-RA 1..570 53..622 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:01:03 Download gff for IP01195.complete
Subject Subject Range Query Range Percent Splice Strand
sisA-RA 1..570 53..622 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:20 Download gff for IP01195.complete
Subject Subject Range Query Range Percent Splice Strand
sisA-RA 5..768 1..763 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:51 Download gff for IP01195.complete
Subject Subject Range Query Range Percent Splice Strand
sisA-RA 5..768 1..763 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:12:10 Download gff for IP01195.complete
Subject Subject Range Query Range Percent Splice Strand
sisA-RA 16..779 1..763 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:16 Download gff for IP01195.complete
Subject Subject Range Query Range Percent Splice Strand
sisA-RA 5..768 1..763 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:01:03 Download gff for IP01195.complete
Subject Subject Range Query Range Percent Splice Strand
sisA-RA 16..779 1..763 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:27:43 Download gff for IP01195.complete
Subject Subject Range Query Range Percent Splice Strand
X 11321579..11322342 1..763 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:27:43 Download gff for IP01195.complete
Subject Subject Range Query Range Percent Splice Strand
X 11321579..11322342 1..763 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:27:43 Download gff for IP01195.complete
Subject Subject Range Query Range Percent Splice Strand
X 11321579..11322342 1..763 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:12:10 Download gff for IP01195.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11215612..11216375 1..763 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:51 Download gff for IP01195.complete
Subject Subject Range Query Range Percent Splice Strand
X 11329677..11330440 1..763 99   Minus

IP01195.hyp Sequence

Translation from 0 to 629

> IP01195.hyp
KSRREQSQTTSHIEKNHHGTESSLLAHSELRGHGSRIRTVSRKQFTRTID
SIVNIIEAGADRGAGVPAAASSQNALRRRGATLRRPDAPGESHCCGAPCT
AAAENGACYGLPRIGFRIRFRFWFGCQGCPASEGRVVPQIPLQQQDQEGQ
AALPAQIRQRAAEEERRHVGHDAGCDCPGGEAAARAGISRRHTRADAGHF
RPGNGAVIS*
Sequence IP01195.hyp has no blast hits.

IP01195.pep Sequence

Translation from 1 to 621

> IP01195.pep
NLDESSHRPRHTSKKITMERSHLYLPTLSYAAMGHVYAPYRGSSSPALST
ASSTSSKPEQIEELVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAP
PPLKTELAMDCRGSGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAK
LRFRHKFVSGQLKKSAVMLDTMRDVIAQAERQLLERGYPAATLERMRATF
GLEMEQ*

IP01195.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22354-PA 190 GF22354-PA 1..186 18..204 617 69.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18864-PA 188 GG18864-PA 1..188 18..206 947 96.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12223-PA 195 GH12223-PA 1..184 18..203 537 58.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
sisA-PA 189 CG1641-PA 1..189 18..206 960 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15754-PA 196 GI15754-PA 1..184 18..203 524 59.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20294-PA 285 GL20294-PA 114..276 55..203 446 57.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\sisA-PA 206 GA14068-PA 1..197 18..203 467 53.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11249-PA 189 GM11249-PA 1..189 18..206 990 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24535-PA 189 GD24535-PA 1..189 18..206 993 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\sisA-PA 195 GJ18613-PA 1..184 18..203 513 56.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16516-PA 209 GK16516-PA 1..197 18..202 484 53 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17305-PA 189 GE17305-PA 1..189 18..206 836 94.7 Plus