Clone IP01224 Report

Search the DGRC for IP01224

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:12
Well:24
Vector:pOT2
Associated Gene/TranscriptCG17195-RA
Protein status:IP01224.pep: gold
Preliminary Size:737
Sequenced Size:942

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17195 2005-01-01 Successful iPCR screen
CG17195 2008-04-29 Release 5.5 accounting
CG17195 2008-08-15 Release 5.9 accounting
CG17195 2008-12-18 5.12 accounting

Clone Sequence Records

IP01224.complete Sequence

942 bp (942 high quality bases) assembled on 2005-08-25

GenBank Submission: BT022183

> IP01224.complete
TTTCAAAATCCTAAAAAATGTGCTACGTGAATAGATTTTGCCATTACTTT
GCCAATCGCTACCCGAAGAACTTTGTGAGGATAGTGCATCCACTTTCGAT
AGTTTTCGTCCTGTGCAGCACAGCTTTCTTCTTCTCACTGCAGATGTTTT
ACATTGCGCCCAAAGTGTTTGGCGACATTGCTTACAAGCTCTACTGGATA
TTGGTCACCTTCATAACGCACAACATACTTGGTAACATGCTGGCCTGCTA
TATGACTAGCTCATCGGTAAACACCTTGTCCAAGGACTCCCGATGCCCGA
ATCCAGAGGATGAGCCCCTGTGGCACTATTGCGAATCGTGTAAAAAGCTG
AGATCGCCACGATCCTGGCACTGCGTTTTGTGCAACACCTGCATTTTGAG
ACGGGACCACCACTGTATATTCACGGGCACTTGCATTGGACACAATAATC
AACGCTTTTTCTTCTGGTTCACATTTTATTTAACGCTCGGCTTAGTCACA
AGCTTTGCAACATTTTGTATGTTTATCCTGCAGAATGGCGGTAACTTCAT
GAGTCTCTCGTCTGTGATTTTTAATTTAATAACTAGGACTTTTTTCCAAA
ATTATACTGGCAATACTTTTGAGACCATTGCCTTCCTCTTGAATATAAGC
GCCAGCTATATGCCTGCCTTTATGTTGGCATATCAAATGCAGATTTTAAG
CCAAAACTCTACCTACTATAATATTTTTGATTGCACCTACGATCTGGGTT
TCCGAAAGAACTGCCAGACAATAATGGGCCAACGAGGACTTTGGACTTTT
ATATCGCCCTTGCTGAAGAGTCCTTTGCCCCATGACGGTGCACATTGGCA
GATGAAGCAGTCTCACTAAATTAATAGACGTATTACTAAATTATTGAAAA
ATATATATCGATTTTAACAAGCCAAAAAAAAAAAAAAAAAAA

IP01224.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG17195-RA 923 CG17195-RA 1..923 1..923 4615 100 Plus
CG17196-RB 844 CG17196-RB 220..389 312..481 310 78.8 Plus
CG17196-RA 919 CG17196-RA 295..464 312..481 310 78.8 Plus
CG17196-RB 844 CG17196-RB 626..722 739..835 275 85.5 Plus
CG17196-RA 919 CG17196-RA 701..797 739..835 275 85.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21599258..21600180 923..1 4510 99.2 Minus
chr3R 27901430 chr3R 21598725..21598894 481..312 310 78.8 Minus
chr3R 27901430 chr3R 21598392..21598564 835..663 295 78 Minus
chr3R 27901430 chr3R 21597803..21597918 472..357 220 79.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:30:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25776274..25777198 925..1 4625 100 Minus
3R 32079331 3R 25775743..25775912 481..312 310 78.8 Minus
3R 32079331 3R 25775410..25775582 835..663 295 78 Minus
3R 32079331 3R 25774821..25774936 472..357 220 79.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:21:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25517105..25518029 925..1 4625 100 Minus
3R 31820162 3R 25516574..25516743 481..312 310 78.8 Minus
3R 31820162 3R 25516241..25516337 835..739 275 85.5 Minus
3R 31820162 3R 25515652..25515767 472..357 220 79.3 Minus
3R 31820162 3R 25518567..25518655 451..363 145 77.5 Minus
Blast to na_te.dros performed on 2019-03-16 18:05:36 has no hits.

IP01224.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:06:26 Download gff for IP01224.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21599258..21600180 1..923 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:14:25 Download gff for IP01224.complete
Subject Subject Range Query Range Percent Splice Strand
CG17195-RA 1..852 18..869 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:53:15 Download gff for IP01224.complete
Subject Subject Range Query Range Percent Splice Strand
CG17195-RA 1..852 18..869 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:09:16 Download gff for IP01224.complete
Subject Subject Range Query Range Percent Splice Strand
CG17195-RA 1..852 18..869 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:33:57 Download gff for IP01224.complete
Subject Subject Range Query Range Percent Splice Strand
CG17195-RA 1..852 18..869 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:30:03 Download gff for IP01224.complete
Subject Subject Range Query Range Percent Splice Strand
CG17195-RA 1..852 18..869 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:28:08 Download gff for IP01224.complete
Subject Subject Range Query Range Percent Splice Strand
CG17195-RA 1..923 1..923 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:53:15 Download gff for IP01224.complete
Subject Subject Range Query Range Percent Splice Strand
CG17195-RA 1..923 1..923 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:09:16 Download gff for IP01224.complete
Subject Subject Range Query Range Percent Splice Strand
CG17195-RA 1..923 1..923 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:33:58 Download gff for IP01224.complete
Subject Subject Range Query Range Percent Splice Strand
CG17195-RA 1..923 1..923 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:30:03 Download gff for IP01224.complete
Subject Subject Range Query Range Percent Splice Strand
CG17195-RA 1..923 1..923 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:06:26 Download gff for IP01224.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25776276..25777198 1..923 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:06:26 Download gff for IP01224.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25776276..25777198 1..923 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:06:26 Download gff for IP01224.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25776276..25777198 1..923 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:09:16 Download gff for IP01224.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21601998..21602920 1..923 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:12:33 Download gff for IP01224.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25517107..25518029 1..923 100   Minus

IP01224.hyp Sequence

Translation from 17 to 868

> IP01224.hyp
MCYVNRFCHYFANRYPKNFVRIVHPLSIVFVLCSTAFFFSLQMFYIAPKV
FGDIAYKLYWILVTFITHNILGNMLACYMTSSSVNTLSKDSRCPNPEDEP
LWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFW
FTFYLTLGLVTSFATFCMFILQNGGNFMSLSSVIFNLITRTFFQNYTGNT
FETIAFLLNISASYMPAFMLAYQMQILSQNSTYYNIFDCTYDLGFRKNCQ
TIMGQRGLWTFISPLLKSPLPHDGAHWQMKQSH*

IP01224.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG17195-PA 283 CG17195-PA 1..283 1..283 1573 100 Plus
CG17196-PA 276 CG17196-PA 1..274 1..281 825 54.4 Plus
CG17197-PB 290 CG17197-PB 1..275 1..281 722 46.6 Plus
CG17196-PB 251 CG17196-PB 1..249 1..281 715 49.8 Plus
CG17196-PC 253 CG17196-PC 1..251 1..281 714 49.5 Plus

IP01224.pep Sequence

Translation from 17 to 868

> IP01224.pep
MCYVNRFCHYFANRYPKNFVRIVHPLSIVFVLCSTAFFFSLQMFYIAPKV
FGDIAYKLYWILVTFITHNILGNMLACYMTSSSVNTLSKDSRCPNPEDEP
LWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFW
FTFYLTLGLVTSFATFCMFILQNGGNFMSLSSVIFNLITRTFFQNYTGNT
FETIAFLLNISASYMPAFMLAYQMQILSQNSTYYNIFDCTYDLGFRKNCQ
TIMGQRGLWTFISPLLKSPLPHDGAHWQMKQSH*

IP01224.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19937-PA 305 GF19937-PA 1..285 1..282 660 44.9 Plus
Dana\GF23940-PA 185 GF23940-PA 1..183 1..179 493 48.6 Plus
Dana\GF23939-PA 259 GF23939-PA 1..247 43..278 483 39.3 Plus
Dana\GF18232-PA 295 GF18232-PA 2..289 4..282 465 35.4 Plus
Dana\GF24551-PA 209 GF24551-PA 3..205 61..281 458 38.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12218-PA 283 GG12218-PA 1..283 1..283 1225 78.8 Plus
Dere\GG12220-PA 278 GG12220-PA 1..276 1..281 778 52.3 Plus
Dere\GG13586-PA 288 GG13586-PA 1..283 1..281 713 48.1 Plus
Dere\GG12221-PA 281 GG12221-PA 1..276 1..282 666 45.4 Plus
Dere\GG12217-PA 302 GG12217-PA 27..300 9..281 527 40.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:15:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25236-PA 308 GH25236-PA 9..297 4..278 465 36 Plus
Dgri\GH23419-PA 308 GH23419-PA 9..297 4..278 451 36 Plus
Dgri\GH20531-PA 286 GH20531-PA 6..277 13..283 362 33.1 Plus
Dgri\GH21619-PA 280 GH21619-PA 35..273 42..277 345 32.2 Plus
Dgri\GH20532-PA 279 GH20532-PA 47..271 56..278 296 30.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG17195-PA 283 CG17195-PA 1..283 1..283 1573 100 Plus
CG17196-PA 276 CG17196-PA 1..274 1..281 825 54.4 Plus
CG17197-PB 290 CG17197-PB 1..275 1..281 722 46.6 Plus
CG17196-PB 251 CG17196-PB 1..249 1..281 715 49.8 Plus
CG17196-PC 253 CG17196-PC 1..251 1..281 714 49.5 Plus
CG13029-PC 288 CG13029-PC 1..284 1..282 700 44.9 Plus
CG17198-PB 299 CG17198-PB 45..298 32..282 504 37.5 Plus
CG17198-PA 299 CG17198-PA 45..298 32..282 504 37.5 Plus
CG4956-PA 302 CG4956-PA 40..301 22..282 502 37.9 Plus
CG10344-PB 278 CG10344-PB 5..272 12..279 387 33.1 Plus
CG4676-PA 284 CG4676-PA 23..274 28..278 372 30.7 Plus
CG18810-PA 300 CG18810-PA 21..278 29..274 317 29 Plus
CG10344-PA 198 CG10344-PA 5..148 12..160 295 40.9 Plus
CG13029-PD 132 CG13029-PD 50..128 204..282 209 49.4 Plus
CG34449-PC 500 CG34449-PC 18..180 28..184 196 29.7 Plus
CG34449-PD 523 CG34449-PD 18..180 28..184 196 29.7 Plus
CG34449-PF 852 CG34449-PF 18..180 28..184 196 29.7 Plus
CG34449-PB 911 CG34449-PB 18..180 28..184 196 29.7 Plus
CG34449-PA 934 CG34449-PA 18..180 28..184 196 29.7 Plus
CG34449-PE 1052 CG34449-PE 18..180 28..184 196 29.7 Plus
CG34449-PG 906 CG34449-PG 18..175 28..184 179 28.7 Plus
CG5196-PA 427 CG5196-PA 20..155 26..167 174 27.3 Plus
Dnz1-PA 276 CG6627-PA 81..163 82..164 172 36.1 Plus
CG5880-PA 381 CG5880-PA 57..200 18..174 169 28.7 Plus
CG5196-PB 395 CG5196-PB 4..123 43..167 167 27.8 Plus
app-PO 382 CG42318-PO 148..208 104..164 161 45.9 Plus
app-PI 398 CG42318-PI 148..208 104..164 161 45.9 Plus
app-PH 398 CG42318-PH 148..208 104..164 161 45.9 Plus
app-PR 693 CG42318-PR 148..208 104..164 161 45.9 Plus
app-PM 693 CG42318-PM 148..208 104..164 161 45.9 Plus
app-PL 693 CG42318-PL 148..208 104..164 161 45.9 Plus
app-PT 693 CG42318-PT 148..208 104..164 161 45.9 Plus
app-PK 755 CG42318-PK 148..208 104..164 161 45.9 Plus
app-PJ 755 CG42318-PJ 148..208 104..164 161 45.9 Plus
CG8314-PA 293 CG8314-PA 119..188 101..169 159 35.7 Plus
CG4483-PA 435 CG4483-PA 86..149 97..160 154 35.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:15:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10345-PA 308 GI10345-PA 22..296 18..277 462 37.8 Plus
Dmoj\GI18977-PA 282 GI18977-PA 6..277 13..283 357 32.6 Plus
Dmoj\GI20071-PA 241 GI20071-PA 8..234 52..277 314 33.2 Plus
Dmoj\GI18978-PA 275 GI18978-PA 29..266 39..283 285 30.8 Plus
Dmoj\GI18972-PA 271 GI18972-PA 32..252 52..279 283 32.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:15:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16922-PA 285 GL16922-PA 5..279 12..282 360 31 Plus
Dper\GL22296-PA 270 GL22296-PA 14..270 11..263 354 31.1 Plus
Dper\GL11193-PA 250 GL11193-PA 1..245 43..283 353 33.3 Plus
Dper\GL27308-PA 426 GL27308-PA 7..155 18..167 164 26.9 Plus
Dper\GL19029-PA 275 GL19029-PA 81..199 82..192 161 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:15:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18553-PB 302 GA18553-PB 26..298 11..281 481 34.8 Plus
Dpse\GA10260-PA 285 GA10260-PA 5..279 12..282 359 31 Plus
Dpse\GA18348-PA 250 GA18348-PA 1..245 43..283 353 33.3 Plus
Dpse\GA10260-PB 256 GA10260-PB 5..198 12..195 281 33.3 Plus
Dpse\GA19735-PA 275 GA19735-PA 81..199 82..192 161 33.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:15:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10219-PA 283 GM10219-PA 1..282 1..282 1415 91.8 Plus
Dsec\GM10220-PA 276 GM10220-PA 1..274 1..281 782 54.2 Plus
Dsec\GM10221-PA 288 GM10221-PA 1..277 1..283 662 46 Plus
Dsec\GM25666-PA 288 GM25666-PA 1..284 1..282 660 44.8 Plus
Dsec\GM10218-PA 302 GM10218-PA 33..301 15..282 499 38.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18170-PA 283 GD18170-PA 1..282 1..282 1429 92.9 Plus
Dsim\GD18171-PA 276 GD18171-PA 1..274 1..281 772 53.9 Plus
Dsim\GD14673-PA 288 GD14673-PA 1..284 1..282 671 45.1 Plus
Dsim\GD18172-PA 300 GD18172-PA 46..299 32..282 502 38.7 Plus
Dsim\GD18169-PA 302 GD18169-PA 40..301 22..282 491 38.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10196-PA 321 GJ10196-PA 26..309 11..278 469 37.4 Plus
Dvir\GJ21165-PA 248 GJ21165-PA 3..242 42..278 375 34 Plus
Dvir\GJ19937-PA 287 GJ19937-PA 6..278 13..283 363 32.3 Plus
Dvir\GJ21996-PA 269 GJ21996-PA 6..263 13..281 302 31.7 Plus
Dvir\GJ19938-PA 213 GJ19938-PA 1..202 70..274 244 32.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18989-PA 273 GK18989-PA 4..267 20..277 469 35.8 Plus
Dwil\GK18990-PA 278 GK18990-PA 4..275 15..281 461 34.8 Plus
Dwil\GK20822-PA 269 GK20822-PA 5..269 12..282 319 30.9 Plus
Dwil\GK14088-PA 279 GK14088-PA 66..279 69..282 312 31.5 Plus
Dwil\GK14400-PA 422 GK14400-PA 4..146 15..158 159 28 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10666-PA 283 GE10666-PA 1..283 1..283 1190 77 Plus
Dyak\GE10667-PA 276 GE10667-PA 1..274 1..281 790 55.1 Plus
Dyak\GE19883-PA 288 GE19883-PA 1..282 1..280 699 47.5 Plus
Dyak\GE10668-PA 276 GE10668-PA 1..271 1..282 624 41.9 Plus
Dyak\GE10669-PA 300 GE10669-PA 40..299 26..282 519 39.7 Plus