BDGP Sequence Production Resources |
Search the DGRC for IP01323
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 13 |
Well: | 23 |
Vector: | pOT2 |
Associated Gene/Transcript | Rpb4-RF |
Protein status: | IP01323.pep: gold |
Preliminary Size: | 389 |
Sequenced Size: | 609 |
Gene | Date | Evidence |
---|---|---|
CG31237 | 2005-01-01 | Successful iPCR screen |
Rpb4 | 2008-04-29 | Release 5.5 accounting |
Rpb4 | 2008-08-15 | Release 5.9 accounting |
Rpb4 | 2008-12-18 | 5.12 accounting |
609 bp (609 high quality bases) assembled on 2005-08-25
GenBank Submission: BT022168
> IP01323.complete TCTTAGCTCACTATGTCTTTTATGAACCCCGTGGATATGGTGGATGAGGA CGCCGCCGACCTGCAGTTTCCCAAAGAGTTCGAAAATGCCGAGACGCTGC TGATATCGGAGGTGCACATGCTTCTCGATCACCGAAAGCGACAAAACGAA TCCGCCGACGAGGAGCAAGAGTTCTCCGAGGTCTTCATGAAGACCTACGC CTACACAGATAGTTTTCGAAAGTTCAAAAACAAGGAGACGATAATGTCTG CGCGAAGCTTGCTGATGCAGAAAAAGCTGCACAAATTCGAACTGGCCGCA CTGGGTAATTTGTGTCCGGAGGCGCCCGAGGAGGCCAAGGCGCTGATTCC TTCACTAGAGGGTCGCTTCGAGGATGAGGAGCTGCGCCAAATACTCGACG ATATCGGCACTAAACGCAGCTTACAATACTAATTACTACTACGTATAAAT ATAGTTTAGATATAAAGTCATGGTCCACTTACACAATAAAGTGAAGAACA GCAAGAATTTTAAGTAAATGCAGAATATACACTGTAACAAAAATCAACAA AGTCTAAATACAATGTAATTATATCAAACAAAAAAAAAAAAAAAAAAAAA AAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Rpb4.a | 2217 | Rpb4.a | 1665..2173 | 75..583 | 2485 | 99.2 | Plus |
Rpb4-RA | 2395 | Rpb4-RA | 1843..2351 | 75..583 | 2485 | 99.2 | Plus |
Rpb4-RE | 2367 | Rpb4-RE | 1815..2323 | 75..583 | 2485 | 99.2 | Plus |
Rpb4.a | 2217 | Rpb4.a | 73..148 | 1..76 | 380 | 100 | Plus |
Rpb4-RA | 2395 | Rpb4-RA | 91..166 | 1..76 | 380 | 100 | Plus |
Rpb4-RE | 2367 | Rpb4-RE | 78..153 | 1..76 | 380 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 14077185..14077508 | 579..256 | 1605 | 99.7 | Minus |
chr3R | 27901430 | chr3R | 14077569..14077751 | 257..75 | 870 | 98.4 | Minus |
chr3R | 27901430 | chr3R | 14079611..14079686 | 76..1 | 380 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 18252887..18253214 | 583..256 | 1625 | 99.7 | Minus |
3R | 32079331 | 3R | 18253275..18253457 | 257..75 | 870 | 98.4 | Minus |
3R | 32079331 | 3R | 18255317..18255392 | 76..1 | 380 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 17993718..17994045 | 583..256 | 1625 | 99.6 | Minus |
3R | 31820162 | 3R | 17994106..17994288 | 257..75 | 870 | 98.3 | Minus |
3R | 31820162 | 3R | 17996148..17996223 | 76..1 | 380 | 100 | Minus |
3L | 28103327 | 3L | 6162639..6162676 | 609..572 | 190 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 14077185..14077506 | 258..579 | 99 | <- | Minus |
chr3R | 14077569..14077749 | 77..257 | 98 | <- | Minus |
chr3R | 14079611..14079686 | 1..76 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb4-RF | 1..420 | 13..432 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb4-RF | 1..420 | 13..432 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb4-RF | 1..420 | 13..432 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb4-RD | 1..63 | 13..75 | 100 | -> | Plus |
Rpb4-RD | 98..453 | 76..432 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb4-RF | 1..420 | 13..432 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb4-RA | 73..147 | 1..75 | 100 | -> | Plus |
Rpb4-RA | 1827..2329 | 76..579 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb4-RA | 78..152 | 1..75 | 100 | -> | Plus |
Rpb4-RA | 1832..2334 | 76..579 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb4-RF | 96..674 | 1..579 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb4-RB | 73..147 | 1..76 | 98 | -> | Plus |
Rpb4-RB | 1872..2374 | 77..579 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb4-RF | 96..674 | 1..579 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18252891..18253212 | 258..579 | 99 | <- | Minus |
3R | 18253275..18253455 | 77..257 | 98 | <- | Minus |
3R | 18255317..18255392 | 1..76 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18252891..18253212 | 258..579 | 99 | <- | Minus |
3R | 18253275..18253455 | 77..257 | 98 | <- | Minus |
3R | 18255317..18255392 | 1..76 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18252891..18253212 | 258..579 | 99 | <- | Minus |
3R | 18253275..18253455 | 77..257 | 98 | <- | Minus |
3R | 18255317..18255392 | 1..76 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 14078613..14078934 | 258..579 | 99 | <- | Minus |
arm_3R | 14078997..14079177 | 77..257 | 98 | <- | Minus |
arm_3R | 14081039..14081114 | 1..76 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17993722..17994043 | 258..579 | 99 | <- | Minus |
3R | 17994106..17994286 | 77..257 | 98 | <- | Minus |
3R | 17996148..17996223 | 1..76 | 100 | Minus |
Translation from 12 to 431
> IP01323.hyp MSFMNPVDMVDEDAADLQFPKEFENAETLLISEVHMLLDHRKRQNESADE EQEFSEVFMKTYAYTDSFRKFKNKETIMSARSLLMQKKLHKFELAALGNL CPEAPEEAKALIPSLEGRFEDEELRQILDDIGTKRSLQY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Rpb4-PF | 139 | CG43662-PF | 1..139 | 1..139 | 706 | 100 | Plus |
Translation from 12 to 431
> IP01323.pep MSFMNPVDMVDEDAADLQFPKEFENAETLLISEVHMLLDHRKRQNESADE EQEFSEVFMKTYAYTDSFRKFKNKETIMSARSLLMQKKLHKFELAALGNL CPEAPEEAKALIPSLEGRFEDEELRQILDDIGTKRSLQY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23150-PA | 624 | GF23150-PA | 507..624 | 22..139 | 606 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16596-PA | 104 | GG16596-PA | 1..104 | 36..139 | 538 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19030-PA | 104 | GH19030-PA | 1..104 | 36..139 | 538 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Rpb4-PF | 139 | CG43662-PF | 1..139 | 1..139 | 706 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22842-PA | 104 | GI22842-PA | 1..104 | 36..139 | 538 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22027-PA | 629 | GL22027-PA | 512..629 | 22..139 | 607 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA30251-PA | 139 | GA30251-PA | 1..139 | 1..139 | 722 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15313-PA | 137 | GM15313-PA | 17..137 | 19..139 | 617 | 98.3 | Plus |
Dsec\GM10729-PA | 146 | GM10729-PA | 9..126 | 19..139 | 582 | 93.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20190-PA | 782 | GD20190-PA | 665..782 | 22..139 | 609 | 99.2 | Plus |
Dsim\GD20190-PA | 782 | GD20190-PA | 508..568 | 22..82 | 310 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24701-PA | 104 | GJ24701-PA | 1..104 | 36..139 | 538 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22783-PA | 116 | GK22783-PA | 3..116 | 22..139 | 569 | 94.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25223-PA | 104 | GE25223-PA | 1..104 | 36..139 | 538 | 99 | Plus |