Clone IP01323 Report

Search the DGRC for IP01323

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:13
Well:23
Vector:pOT2
Associated Gene/TranscriptRpb4-RF
Protein status:IP01323.pep: gold
Preliminary Size:389
Sequenced Size:609

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31237 2005-01-01 Successful iPCR screen
Rpb4 2008-04-29 Release 5.5 accounting
Rpb4 2008-08-15 Release 5.9 accounting
Rpb4 2008-12-18 5.12 accounting

Clone Sequence Records

IP01323.complete Sequence

609 bp (609 high quality bases) assembled on 2005-08-25

GenBank Submission: BT022168

> IP01323.complete
TCTTAGCTCACTATGTCTTTTATGAACCCCGTGGATATGGTGGATGAGGA
CGCCGCCGACCTGCAGTTTCCCAAAGAGTTCGAAAATGCCGAGACGCTGC
TGATATCGGAGGTGCACATGCTTCTCGATCACCGAAAGCGACAAAACGAA
TCCGCCGACGAGGAGCAAGAGTTCTCCGAGGTCTTCATGAAGACCTACGC
CTACACAGATAGTTTTCGAAAGTTCAAAAACAAGGAGACGATAATGTCTG
CGCGAAGCTTGCTGATGCAGAAAAAGCTGCACAAATTCGAACTGGCCGCA
CTGGGTAATTTGTGTCCGGAGGCGCCCGAGGAGGCCAAGGCGCTGATTCC
TTCACTAGAGGGTCGCTTCGAGGATGAGGAGCTGCGCCAAATACTCGACG
ATATCGGCACTAAACGCAGCTTACAATACTAATTACTACTACGTATAAAT
ATAGTTTAGATATAAAGTCATGGTCCACTTACACAATAAAGTGAAGAACA
GCAAGAATTTTAAGTAAATGCAGAATATACACTGTAACAAAAATCAACAA
AGTCTAAATACAATGTAATTATATCAAACAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAA

IP01323.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb4.a 2217 Rpb4.a 1665..2173 75..583 2485 99.2 Plus
Rpb4-RA 2395 Rpb4-RA 1843..2351 75..583 2485 99.2 Plus
Rpb4-RE 2367 Rpb4-RE 1815..2323 75..583 2485 99.2 Plus
Rpb4.a 2217 Rpb4.a 73..148 1..76 380 100 Plus
Rpb4-RA 2395 Rpb4-RA 91..166 1..76 380 100 Plus
Rpb4-RE 2367 Rpb4-RE 78..153 1..76 380 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:38:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14077185..14077508 579..256 1605 99.7 Minus
chr3R 27901430 chr3R 14077569..14077751 257..75 870 98.4 Minus
chr3R 27901430 chr3R 14079611..14079686 76..1 380 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:31:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18252887..18253214 583..256 1625 99.7 Minus
3R 32079331 3R 18253275..18253457 257..75 870 98.4 Minus
3R 32079331 3R 18255317..18255392 76..1 380 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:21:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17993718..17994045 583..256 1625 99.6 Minus
3R 31820162 3R 17994106..17994288 257..75 870 98.3 Minus
3R 31820162 3R 17996148..17996223 76..1 380 100 Minus
3L 28103327 3L 6162639..6162676 609..572 190 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:38:31 has no hits.

IP01323.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:39:33 Download gff for IP01323.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14077185..14077506 258..579 99 <- Minus
chr3R 14077569..14077749 77..257 98 <- Minus
chr3R 14079611..14079686 1..76 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:14:46 Download gff for IP01323.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb4-RF 1..420 13..432 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:52:54 Download gff for IP01323.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb4-RF 1..420 13..432 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:58:28 Download gff for IP01323.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb4-RF 1..420 13..432 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:33:38 Download gff for IP01323.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb4-RD 1..63 13..75 100 -> Plus
Rpb4-RD 98..453 76..432 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:42:56 Download gff for IP01323.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb4-RF 1..420 13..432 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:27:35 Download gff for IP01323.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb4-RA 73..147 1..75 100 -> Plus
Rpb4-RA 1827..2329 76..579 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:52:54 Download gff for IP01323.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb4-RA 78..152 1..75 100 -> Plus
Rpb4-RA 1832..2334 76..579 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:58:28 Download gff for IP01323.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb4-RF 96..674 1..579 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:33:38 Download gff for IP01323.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb4-RB 73..147 1..76 98 -> Plus
Rpb4-RB 1872..2374 77..579 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:42:56 Download gff for IP01323.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb4-RF 96..674 1..579 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:33 Download gff for IP01323.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18252891..18253212 258..579 99 <- Minus
3R 18253275..18253455 77..257 98 <- Minus
3R 18255317..18255392 1..76 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:33 Download gff for IP01323.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18252891..18253212 258..579 99 <- Minus
3R 18253275..18253455 77..257 98 <- Minus
3R 18255317..18255392 1..76 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:33 Download gff for IP01323.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18252891..18253212 258..579 99 <- Minus
3R 18253275..18253455 77..257 98 <- Minus
3R 18255317..18255392 1..76 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:58:28 Download gff for IP01323.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14078613..14078934 258..579 99 <- Minus
arm_3R 14078997..14079177 77..257 98 <- Minus
arm_3R 14081039..14081114 1..76 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:12:11 Download gff for IP01323.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17993722..17994043 258..579 99 <- Minus
3R 17994106..17994286 77..257 98 <- Minus
3R 17996148..17996223 1..76 100   Minus

IP01323.hyp Sequence

Translation from 12 to 431

> IP01323.hyp
MSFMNPVDMVDEDAADLQFPKEFENAETLLISEVHMLLDHRKRQNESADE
EQEFSEVFMKTYAYTDSFRKFKNKETIMSARSLLMQKKLHKFELAALGNL
CPEAPEEAKALIPSLEGRFEDEELRQILDDIGTKRSLQY*

IP01323.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb4-PF 139 CG43662-PF 1..139 1..139 706 100 Plus

IP01323.pep Sequence

Translation from 12 to 431

> IP01323.pep
MSFMNPVDMVDEDAADLQFPKEFENAETLLISEVHMLLDHRKRQNESADE
EQEFSEVFMKTYAYTDSFRKFKNKETIMSARSLLMQKKLHKFELAALGNL
CPEAPEEAKALIPSLEGRFEDEELRQILDDIGTKRSLQY*

IP01323.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23150-PA 624 GF23150-PA 507..624 22..139 606 98.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16596-PA 104 GG16596-PA 1..104 36..139 538 99 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:13:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19030-PA 104 GH19030-PA 1..104 36..139 538 99 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:52
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb4-PF 139 CG43662-PF 1..139 1..139 706 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:13:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22842-PA 104 GI22842-PA 1..104 36..139 538 99 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:13:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22027-PA 629 GL22027-PA 512..629 22..139 607 98.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:13:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30251-PA 139 GA30251-PA 1..139 1..139 722 99.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15313-PA 137 GM15313-PA 17..137 19..139 617 98.3 Plus
Dsec\GM10729-PA 146 GM10729-PA 9..126 19..139 582 93.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20190-PA 782 GD20190-PA 665..782 22..139 609 99.2 Plus
Dsim\GD20190-PA 782 GD20190-PA 508..568 22..82 310 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:13:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24701-PA 104 GJ24701-PA 1..104 36..139 538 99 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:13:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22783-PA 116 GK22783-PA 3..116 22..139 569 94.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:13:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25223-PA 104 GE25223-PA 1..104 36..139 538 99 Plus