Clone IP01459 Report

Search the DGRC for IP01459

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:14
Well:59
Vector:pOT2
Associated Gene/TranscriptCG4956-RA
Protein status:IP01459.pep: gold
Preliminary Size:858
Sequenced Size:1057

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4956 2005-01-01 Successful iPCR screen
CG4956 2008-04-29 Release 5.5 accounting
CG4956 2008-08-15 Release 5.9 accounting
CG4956 2008-12-18 5.12 accounting

Clone Sequence Records

IP01459.complete Sequence

1057 bp (1057 high quality bases) assembled on 2005-08-25

GenBank Submission: BT022146

> IP01459.complete
CAAGGCAGTTCTGGTGCCCAAAGTCTATTAAAAATAATTTATTTGATAAA
TTTAACAATACGTCTGTCATTTATAAATGCTTCGATTTCGAGTTTTATTA
AGATCTACTTGCGGTTGGAGTAGAAGAATGTGTTTTCGAGCCGAGGAAGG
GTTTCATCGTCACTTTCAACTACATCGCATAAAAGTTATGGGCCTACTTC
ATCCGTTTTGTGCAATATTTTTACTCTGTCTGATTGGATTGCTGTTTGTC
TATGAATTATGCTACGTTTTGCCGCAAATAACTGATCCCCATGGTATATG
GCACAAATTGTGTTGGTTTATGGGAATTTATACAGTCATCAATATATTGG
GCAACTGGTGGCTCGGCTGTATGACCAATACCTCAGTCGATAGCTTAGTT
CTGGAAAGACAGTATCCTGTGGCAGGTGAGGCTCACCTGTGGCACTACTG
CTCCACATGCCAAAAGCTGGTGCCACCGAGGTCCTGGCACTGTAGTTTGT
GCAACATTTGCATTCTGAAGCGGGATCACCACTGCACCTTCTTTGCCAGT
TGCATTGGCCATAAAAATCAGAGGTATTTCCTTGCCTTCTTGTTTCACCT
GAGCTTTGGCAGCGGACAGGCGCTCGTCTACAATGGCATTTTGAATTGGA
CAAACAAGGCCTTTTTGGTCGTCGATCCTTTGTTGCTAATGTTCCAGGAT
ACAACCCAAGATGCTGATTTCAAATGGAAGTACACAATCGCCAACCTTTT
CAAACTGAATTTATTTCTTTTTGGCGTCCCCCTCTTCATGTTCGTCTTTC
AAATGATAATGGTATATCGGAATAGTACATGCTATAAGATGCTCGATCGC
AGCTATGATGTTGGTTGGAGAAGAAATTTTGATATGGTCTTGGGAAAACG
GCGCTTCTGGATTTTTTTCTCTCCAACGATCTCAAGTCCTCTTCCTACCG
ATGGCACTCAGTGGTTCCAGAAGCAGACAGTGTAAATTTTGTTTGTAAAA
ACTTTGAATATAAGATAGCGAATAAATTCTATTATAATAAAAAAAAAAAA
AAAAAAA

IP01459.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG4956-RA 1038 CG4956-RA 1..1038 1..1038 5190 100 Plus
CG17197-RB 1575 CG17197-RB 429..531 471..573 215 80.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21600250..21601287 1038..1 5040 99 Minus
chr3R 27901430 chr3R 21597821..21597923 573..471 215 80.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:31:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25777267..25778305 1039..1 5195 100 Minus
3R 32079331 3R 25774839..25774941 573..471 215 80.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25518098..25519136 1039..1 5195 100 Minus
3R 31820162 3R 25515670..25515772 573..471 215 80.5 Minus
Blast to na_te.dros performed on 2019-03-16 01:07:05 has no hits.

IP01459.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:07:46 Download gff for IP01459.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21600250..21601287 1..1038 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:15:14 Download gff for IP01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG4956-RA 1..909 77..985 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:52:11 Download gff for IP01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG4956-RA 1..909 77..985 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:53:47 Download gff for IP01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG4956-RA 1..909 77..985 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:33:21 Download gff for IP01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG4956-RA 1..909 77..985 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:24:01 Download gff for IP01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG4956-RA 1..909 77..985 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:27:14 Download gff for IP01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG4956-RA 1..1038 1..1038 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:52:11 Download gff for IP01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG4956-RA 1..1038 1..1038 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:53:47 Download gff for IP01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG4956-RA 1..1038 1..1038 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:33:21 Download gff for IP01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG4956-RA 1..1038 1..1038 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:24:01 Download gff for IP01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG4956-RA 1..1038 1..1038 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:07:46 Download gff for IP01459.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25777268..25778305 1..1038 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:07:46 Download gff for IP01459.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25777268..25778305 1..1038 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:07:46 Download gff for IP01459.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25777268..25778305 1..1038 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:53:47 Download gff for IP01459.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21602990..21604027 1..1038 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:11:26 Download gff for IP01459.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25518099..25519136 1..1038 100   Minus

IP01459.pep Sequence

Translation from 76 to 984

> IP01459.pep
MLRFRVLLRSTCGWSRRMCFRAEEGFHRHFQLHRIKVMGLLHPFCAIFLL
CLIGLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVINILGNWWLGCMT
NTSVDSLVLERQYPVAGEAHLWHYCSTCQKLVPPRSWHCSLCNICILKRD
HHCTFFASCIGHKNQRYFLAFLFHLSFGSGQALVYNGILNWTNKAFLVVD
PLLLMFQDTTQDADFKWKYTIANLFKLNLFLFGVPLFMFVFQMIMVYRNS
TCYKMLDRSYDVGWRRNFDMVLGKRRFWIFFSPTISSPLPTDGTQWFQKQ
TV*

IP01459.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:13:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18232-PA 295 GF18232-PA 21..284 38..296 782 54.9 Plus
Dana\GF19937-PA 305 GF19937-PA 24..280 42..296 491 38.8 Plus
Dana\GF24551-PA 209 GF24551-PA 4..205 82..300 463 42.9 Plus
Dana\GF23939-PA 259 GF23939-PA 1..246 61..296 461 39.9 Plus
Dana\GF13019-PA 280 GF13019-PA 12..270 40..296 399 35.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:13:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12217-PA 302 GG12217-PA 1..302 1..302 1336 81.8 Plus
Dere\GG12221-PA 281 GG12221-PA 24..276 42..301 543 43.5 Plus
Dere\GG12222-PA 288 GG12222-PA 26..285 44..301 528 41.2 Plus
Dere\GG12220-PA 278 GG12220-PA 13..276 31..300 514 39.3 Plus
Dere\GG12218-PA 283 GG12218-PA 24..282 42..301 502 38.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:13:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23419-PA 308 GH23419-PA 3..298 16..298 547 39.5 Plus
Dgri\GH25236-PA 308 GH25236-PA 3..298 16..298 546 38.5 Plus
Dgri\GH20531-PA 286 GH20531-PA 12..276 40..301 394 34.2 Plus
Dgri\GH21619-PA 280 GH21619-PA 20..274 45..297 388 31.7 Plus
Dgri\GH20532-PA 279 GH20532-PA 23..270 52..296 339 32.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG4956-PA 302 CG4956-PA 1..302 1..302 1695 100 Plus
CG17196-PA 276 CG17196-PA 14..274 32..300 546 40.9 Plus
CG17197-PB 290 CG17197-PB 24..271 42..296 542 42 Plus
CG17196-PC 253 CG17196-PC 22..251 63..300 510 42.4 Plus
CG17195-PA 283 CG17195-PA 22..282 40..301 502 37.9 Plus
CG13029-PC 288 CG13029-PC 22..283 40..300 500 39.6 Plus
CG17198-PB 299 CG17198-PB 45..299 50..302 498 39.3 Plus
CG17198-PA 299 CG17198-PA 45..299 50..302 498 39.3 Plus
CG17196-PB 251 CG17196-PB 39..249 84..300 493 43.8 Plus
CG4676-PA 284 CG4676-PA 9..273 34..296 420 31.6 Plus
CG10344-PB 278 CG10344-PB 17..270 45..296 391 33.7 Plus
CG10344-PA 198 CG10344-PA 17..159 45..191 341 42.2 Plus
CG18810-PA 300 CG18810-PA 15..278 41..293 284 26.4 Plus
Dnz1-PA 276 CG6627-PA 93..155 114..176 175 41.3 Plus
CG5880-PA 381 CG5880-PA 102..192 90..178 174 38 Plus
app-PO 382 CG42318-PO 139..201 115..177 168 44.4 Plus
app-PI 398 CG42318-PI 139..201 115..177 168 44.4 Plus
app-PH 398 CG42318-PH 139..201 115..177 168 44.4 Plus
app-PR 693 CG42318-PR 139..201 115..177 168 44.4 Plus
app-PM 693 CG42318-PM 139..201 115..177 168 44.4 Plus
app-PL 693 CG42318-PL 139..201 115..177 168 44.4 Plus
app-PT 693 CG42318-PT 139..201 115..177 168 44.4 Plus
app-PK 755 CG42318-PK 139..201 115..177 168 44.4 Plus
app-PJ 755 CG42318-PJ 139..201 115..177 168 44.4 Plus
CG8314-PA 293 CG8314-PA 116..174 118..176 163 40.7 Plus
CG17287-PA 338 CG17287-PA 123..263 121..273 163 31 Plus
CG13029-PD 132 CG13029-PD 52..127 225..300 156 42.1 Plus
CG4483-PA 435 CG4483-PA 93..169 124..198 156 35.1 Plus
CG34449-PC 500 CG34449-PC 100..152 124..176 155 50.9 Plus
CG34449-PD 523 CG34449-PD 100..152 124..176 155 50.9 Plus
CG34449-PF 852 CG34449-PF 100..152 124..176 155 50.9 Plus
CG34449-PG 906 CG34449-PG 95..147 124..176 155 50.9 Plus
CG34449-PB 911 CG34449-PB 100..152 124..176 155 50.9 Plus
CG34449-PA 934 CG34449-PA 100..152 124..176 155 50.9 Plus
CG34449-PE 1052 CG34449-PE 100..152 124..176 155 50.9 Plus
CG1407-PE 440 CG1407-PE 130..290 124..287 154 28.2 Plus
CG1407-PC 227 CG1407-PC 130..184 124..185 153 41.9 Plus
CG1407-PB 338 CG1407-PB 130..184 124..185 153 41.9 Plus
CG1407-PD 352 CG1407-PD 130..184 124..185 153 41.9 Plus
CG1407-PA 443 CG1407-PA 130..184 124..185 153 41.9 Plus
CG1407-PF 449 CG1407-PF 130..184 124..185 153 41.9 Plus
CG1407-PG 452 CG1407-PG 130..184 124..185 153 41.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:13:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10345-PA 308 GI10345-PA 8..297 22..297 525 41.2 Plus
Dmoj\GI18977-PA 282 GI18977-PA 12..271 40..296 390 33.5 Plus
Dmoj\GI20071-PA 241 GI20071-PA 1..235 65..297 352 35 Plus
Dmoj\GI18978-PA 275 GI18978-PA 29..257 57..293 332 32.2 Plus
Dmoj\GI18972-PA 271 GI18972-PA 4..250 44..296 279 29.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:13:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22296-PA 270 GL22296-PA 8..270 23..282 590 45.6 Plus
Dper\GL16922-PA 285 GL16922-PA 16..274 44..296 385 32.5 Plus
Dper\GL11193-PA 250 GL11193-PA 4..239 64..296 345 32.5 Plus
Dper\GL19029-PA 275 GL19029-PA 87..157 110..179 166 39.4 Plus
Dper\GL25005-PA 267 GL25005-PA 136..202 111..177 162 41.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:13:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18553-PB 302 GA18553-PB 20..294 23..296 724 49.8 Plus
Dpse\GA10260-PA 285 GA10260-PA 16..274 44..296 379 33.2 Plus
Dpse\GA18348-PA 250 GA18348-PA 4..239 64..296 345 32.5 Plus
Dpse\GA10260-PB 256 GA10260-PB 16..167 44..191 322 40.1 Plus
Dpse\GA19735-PA 275 GA19735-PA 87..157 110..179 166 39.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:13:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10218-PA 302 GM10218-PA 1..302 1..302 1457 89.1 Plus
Dsec\GM10220-PA 276 GM10220-PA 13..274 31..300 511 40.4 Plus
Dsec\GM10221-PA 288 GM10221-PA 24..275 42..300 506 41.7 Plus
Dsec\GM25666-PA 288 GM25666-PA 22..284 40..301 483 38.9 Plus
Dsec\GM10219-PA 283 GM10219-PA 22..282 40..301 474 37.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18169-PA 302 GD18169-PA 1..302 1..302 1466 89.7 Plus
Dsim\GD18172-PA 300 GD18172-PA 46..300 50..302 507 41.5 Plus
Dsim\GD18171-PA 276 GD18171-PA 13..274 31..300 502 40 Plus
Dsim\GD14673-PA 288 GD14673-PA 22..284 40..301 494 38.5 Plus
Dsim\GD18170-PA 283 GD18170-PA 22..282 40..301 469 37.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10196-PA 321 GJ10196-PA 8..310 7..298 609 41.7 Plus
Dvir\GJ21165-PA 248 GJ21165-PA 1..241 58..296 390 34.7 Plus
Dvir\GJ19937-PA 287 GJ19937-PA 12..272 40..296 370 32.3 Plus
Dvir\GJ21996-PA 269 GJ21996-PA 12..264 40..301 344 32.7 Plus
Dvir\GJ19938-PA 213 GJ19938-PA 6..202 99..293 295 34.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:13:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18990-PA 278 GK18990-PA 7..271 39..296 565 42.5 Plus
Dwil\GK18989-PA 273 GK18989-PA 11..267 46..296 502 40.1 Plus
Dwil\GK20822-PA 269 GK20822-PA 12..268 40..300 380 33 Plus
Dwil\GK14088-PA 279 GK14088-PA 8..278 34..300 289 29.7 Plus
Dwil\GK18372-PA 275 GK18372-PA 95..162 117..184 167 41.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:13:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10664-PA 302 GE10664-PA 1..302 1..302 1359 82.8 Plus
Dyak\GE10669-PA 300 GE10669-PA 46..300 50..302 538 42.4 Plus
Dyak\GE19883-PA 288 GE19883-PA 15..282 33..299 526 41 Plus
Dyak\GE10667-PA 276 GE10667-PA 13..274 31..300 510 39.5 Plus
Dyak\GE10666-PA 283 GE10666-PA 18..282 36..301 498 37.9 Plus

IP01459.hyp Sequence

Translation from 76 to 984

> IP01459.hyp
MLRFRVLLRSTCGWSRRMCFRAEEGFHRHFQLHRIKVMGLLHPFCAIFLL
CLIGLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVINILGNWWLGCMT
NTSVDSLVLERQYPVAGEAHLWHYCSTCQKLVPPRSWHCSLCNICILKRD
HHCTFFASCIGHKNQRYFLAFLFHLSFGSGQALVYNGILNWTNKAFLVVD
PLLLMFQDTTQDADFKWKYTIANLFKLNLFLFGVPLFMFVFQMIMVYRNS
TCYKMLDRSYDVGWRRNFDMVLGKRRFWIFFSPTISSPLPTDGTQWFQKQ
TV*

IP01459.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:31:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG4956-PA 302 CG4956-PA 1..302 1..302 1695 100 Plus
CG17196-PA 276 CG17196-PA 14..274 32..300 546 40.9 Plus
CG17197-PB 290 CG17197-PB 24..271 42..296 542 42 Plus
CG17196-PC 253 CG17196-PC 22..251 63..300 510 42.4 Plus
CG17195-PA 283 CG17195-PA 22..282 40..301 502 37.9 Plus