Clone IP01483 Report

Search the DGRC for IP01483

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:14
Well:83
Vector:pOT2
Associated Gene/TranscriptCG3781-RA
Protein status:IP01483.pep: gold
Preliminary Size:978
Sequenced Size:985

Clone Sequence Records

IP01483.complete Sequence

985 bp assembled on 2009-06-16

GenBank Submission: BT088824.1

> IP01483.complete
AAAAAGCCACTTCATCTAGTGACCATTTGGAGCTGCCCGTCCGTTTGGAG
CTATTTCACCTACTGGCTACTGTCACCACCTCACACTGAACCGCTCCGAA
ATGGAATCGCCCAGTGCCCGAACTCTCGGGAATTCCCTGGGCGATGACAG
CGGCAACGGGAATGAAAACGGGAATGGAAGTGGAAACGGAAACACCACAA
TGATGCCGCATGGAATCTACCATGAGCGGCAGACACGTCACCTGTGCGGC
CTCCACGCACTGAACAATCTGTTCCAGGGGCCCGACATGTTCTCCAAATC
GGAACTGGACGACTACTGCACCACATTGACCCCGCGCAACTGGCTGAATC
CGCATCGATCGTGGATCGGTTGGGGCAACTACGACGTCAATGTGATCATG
TACGCCCTGCAGCAGCGGAATTGCGAGGCGGTGTGGTTTGATCGACGGCG
GGATCCACACTGTCTCAATCTGAGCGTCATTTTCGGCTTCATTCTCAATG
TACCGGCTCAGATGAGCCTGGGCTACTACATCCCACTGCCCTTCCACATG
CGACACTGGCTGGCACTGCGTCGCTTGAACGGCAGCTACTACAATCTGGA
CTCCAAGCTGCGCGAGCCCAAGTGCCTGGGCACCGAGCAGCAGTTCCTCG
AGTTTCTGGCCACCCAACTGCAGATGGATCACGAGCTATTCCTCGTGTTG
GACGAGGAGACGGACTGCAAGGATAAGAGCCAGCAACGTTGGCTGCTACC
GCAGTTCAGGGATTAATGTTATGGTTAGCACTCCAAATAAAGCTAAAATG
GAGCAGTGCATTAGTTAATTGTACCAATTATTTGATGAAACTAACCAAAA
AGTGCCCTAGAATATGCAAGTTAAACCTTTACCATCCATTTTGCACTGCA
AGTGGAAGCCACCAAAATTATGTATGTAGTAGTAATAAAAGCGACAAGAA
TAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP01483.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:32:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG3781-RA 952 CG3781-RA 1..952 1..952 4760 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:04:51
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6153351..6154301 1..951 4755 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:31:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6261169..6262121 1..953 4765 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6269267..6270219 1..953 4765 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:04:49 has no hits.

IP01483.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:05:36 Download gff for IP01483.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6153351..6154301 1..951 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:37 Download gff for IP01483.complete
Subject Subject Range Query Range Percent Splice Strand
CG3781-RA 1..666 101..766 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:48:04 Download gff for IP01483.complete
Subject Subject Range Query Range Percent Splice Strand
CG3781-RA 1..666 101..766 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:19:16 Download gff for IP01483.complete
Subject Subject Range Query Range Percent Splice Strand
CG3781-RA 1..666 101..766 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:15:09 Download gff for IP01483.complete
Subject Subject Range Query Range Percent Splice Strand
CG3781-RA 1..666 101..766 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-16 15:00:56 Download gff for IP01483.complete
Subject Subject Range Query Range Percent Splice Strand
CG3781-RA 1..880 72..951 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:48:03 Download gff for IP01483.complete
Subject Subject Range Query Range Percent Splice Strand
CG3781-RA 1..951 1..951 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:19:16 Download gff for IP01483.complete
Subject Subject Range Query Range Percent Splice Strand
CG3781-RA 1..951 1..951 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:15:09 Download gff for IP01483.complete
Subject Subject Range Query Range Percent Splice Strand
CG3781-RA 1..951 1..951 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:05:36 Download gff for IP01483.complete
Subject Subject Range Query Range Percent Splice Strand
X 6261169..6262119 1..951 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:05:36 Download gff for IP01483.complete
Subject Subject Range Query Range Percent Splice Strand
X 6261169..6262119 1..951 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:05:36 Download gff for IP01483.complete
Subject Subject Range Query Range Percent Splice Strand
X 6261169..6262119 1..951 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:19:16 Download gff for IP01483.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6155202..6156152 1..951 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:23:36 Download gff for IP01483.complete
Subject Subject Range Query Range Percent Splice Strand
X 6269267..6270217 1..951 100   Plus

IP01483.hyp Sequence

Translation from 100 to 765

> IP01483.hyp
MESPSARTLGNSLGDDSGNGNENGNGSGNGNTTMMPHGIYHERQTRHLCG
LHALNNLFQGPDMFSKSELDDYCTTLTPRNWLNPHRSWIGWGNYDVNVIM
YALQQRNCEAVWFDRRRDPHCLNLSVIFGFILNVPAQMSLGYYIPLPFHM
RHWLALRRLNGSYYNLDSKLREPKCLGTEQQFLEFLATQLQMDHELFLVL
DEETDCKDKSQQRWLLPQFRD*

IP01483.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG3781-PA 221 CG3781-PA 1..221 1..221 1228 100 Plus

IP01483.pep Sequence

Translation from 100 to 765

> IP01483.pep
MESPSARTLGNSLGDDSGNGNENGNGSGNGNTTMMPHGIYHERQTRHLCG
LHALNNLFQGPDMFSKSELDDYCTTLTPRNWLNPHRSWIGWGNYDVNVIM
YALQQRNCEAVWFDRRRDPHCLNLSVIFGFILNVPAQMSLGYYIPLPFHM
RHWLALRRLNGSYYNLDSKLREPKCLGTEQQFLEFLATQLQMDHELFLVL
DEETDCKDKSQQRWLLPQFRD*

IP01483.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:03:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20386-PA 229 GF20386-PA 36..229 39..221 769 75.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:03:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19579-PA 216 GG19579-PA 1..216 1..221 986 88.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:03:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21436-PA 195 GH21436-PA 6..183 38..215 546 55 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG3781-PA 221 CG3781-PA 1..221 1..221 1228 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:03:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20659-PA 189 GI20659-PA 1..185 35..220 559 55 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:03:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11041-PA 193 GL11041-PA 7..182 39..215 520 56.1 Plus
Dper\GL21314-PA 140 GL21314-PA 1..138 100..221 369 54.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:03:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17685-PA 207 GA17685-PA 6..205 38..221 651 62 Plus
Dpse\GA24587-PA 193 GA24587-PA 7..182 39..215 528 56.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:03:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12472-PA 223 GM12472-PA 1..223 1..221 1004 91.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:03:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16790-PA 227 GD16790-PA 1..227 1..221 1022 90.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:03:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15578-PA 191 GJ15578-PA 1..185 35..220 630 59.8 Plus
Dvir\GJ20408-PA 190 GJ20408-PA 1..182 35..215 542 55.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10623-PA 197 GK10623-PA 1..184 35..215 548 53.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16739-PA 221 GE16739-PA 1..221 1..221 1011 91 Plus