Clone IP01714 Report

Search the DGRC for IP01714

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:17
Well:14
Vector:pOT2
Associated Gene/TranscriptNedd8-RA
Protein status:IP01714.pep: gold
Preliminary Size:255
Sequenced Size:430

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10679 2005-01-01 Successful iPCR screen
Nedd8 2008-04-29 Release 5.5 accounting
Nedd8 2008-08-15 Release 5.9 accounting
Nedd8 2008-12-18 5.12 accounting

Clone Sequence Records

IP01714.complete Sequence

430 bp (430 high quality bases) assembled on 2006-01-17

GenBank Submission: BT024445

> IP01714.complete
AGATTTGCAAAAATTTCGGCAATTTTGAATTTGTACAGGAGCGCCTAGTT
AAATACACACAAAATGTTGATCAAAGTGAAGACCCTGACCGGCAAGGAAA
TCGAGATCGACATTGAGCCCACGGACAAGGTAGATCGCATCAAGGAGCGC
GTGGAGGAAAAGGAAGGCATTCCGCCCCAGCAACAGCGTCTTATTTTCTC
CGGCAAGCAAATGAATGACGATAAAACCGCGGCGGACTACAAAGTGCAAG
GTGGATCCGTTCTTCACTTGGTATTGGCTCTGCGAGGAGGTGATTCAATC
CTAACACCTTGTGTGTAACTAGCGTGTTCATAAGTGGAAAACATTCATTT
AAAATTCACTCAAATATATTAAGCTTGAGAAGCGTCATATGGAGAATTAA
TATATGTAAACTAAAAAAAAAAAAAAAAAA

IP01714.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:22:12
Subject Length Description Subject Range Query Range Score Percent Strand
Nedd8-RA 662 Nedd8-RA 111..527 1..417 2085 100 Plus
Nedd8.a 610 Nedd8.a 271..475 213..417 1025 100 Plus
Nedd8.a 610 Nedd8.a 69..271 1..203 1015 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:43:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18949832..18950031 412..213 1000 100 Minus
chr2L 23010047 chr2L 18950091..18950224 213..80 670 100 Minus
chr2L 23010047 chr2L 18950384..18950464 81..1 405 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:32:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:43:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18951142..18951346 417..213 1025 100 Minus
2L 23513712 2L 18951406..18951539 213..80 670 100 Minus
2L 23513712 2L 18951698..18951778 81..1 405 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:14:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18951142..18951346 417..213 1025 100 Minus
2L 23513712 2L 18951406..18951539 213..80 670 100 Minus
2L 23513712 2L 18951698..18951778 81..1 405 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:43:47 has no hits.

IP01714.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:44:53 Download gff for IP01714.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18949832..18950031 213..412 100 <- Minus
chr2L 18950092..18950222 82..212 100 <- Minus
chr2L 18950384..18950464 1..81 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:15:33 Download gff for IP01714.complete
Subject Subject Range Query Range Percent Splice Strand
Nedd8-RA 1..255 64..318 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:39:04 Download gff for IP01714.complete
Subject Subject Range Query Range Percent Splice Strand
Nedd8-RA 1..255 64..318 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:56:29 Download gff for IP01714.complete
Subject Subject Range Query Range Percent Splice Strand
Nedd8-RA 1..255 64..318 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:14:15 Download gff for IP01714.complete
Subject Subject Range Query Range Percent Splice Strand
Nedd8-RA 1..255 64..318 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:01:20 Download gff for IP01714.complete
Subject Subject Range Query Range Percent Splice Strand
Nedd8-RA 1..255 64..318 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:11:08 Download gff for IP01714.complete
Subject Subject Range Query Range Percent Splice Strand
Nedd8-RA 1..255 64..318 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:39:04 Download gff for IP01714.complete
Subject Subject Range Query Range Percent Splice Strand
Nedd8-RA 68..479 1..412 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:56:29 Download gff for IP01714.complete
Subject Subject Range Query Range Percent Splice Strand
Nedd8-RA 60..471 1..412 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:14:15 Download gff for IP01714.complete
Subject Subject Range Query Range Percent Splice Strand
Nedd8-RA 1..255 64..318 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:01:20 Download gff for IP01714.complete
Subject Subject Range Query Range Percent Splice Strand
Nedd8-RA 60..471 1..412 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:44:53 Download gff for IP01714.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18951147..18951346 213..412 100 <- Minus
2L 18951407..18951537 82..212 100 <- Minus
2L 18951698..18951778 1..81 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:44:53 Download gff for IP01714.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18951147..18951346 213..412 100 <- Minus
2L 18951407..18951537 82..212 100 <- Minus
2L 18951698..18951778 1..81 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:44:53 Download gff for IP01714.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18951147..18951346 213..412 100 <- Minus
2L 18951407..18951537 82..212 100 <- Minus
2L 18951698..18951778 1..81 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:56:29 Download gff for IP01714.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18951147..18951346 213..412 100 <- Minus
arm_2L 18951407..18951537 82..212 100 <- Minus
arm_2L 18951698..18951778 1..81 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:01:52 Download gff for IP01714.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18951147..18951346 213..412 100 <- Minus
2L 18951407..18951537 82..212 100 <- Minus
2L 18951698..18951778 1..81 100   Minus

IP01714.hyp Sequence

Translation from 63 to 317

> IP01714.hyp
MLIKVKTLTGKEIEIDIEPTDKVDRIKERVEEKEGIPPQQQRLIFSGKQM
NDDKTAADYKVQGGSVLHLVLALRGGDSILTPCV*

IP01714.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:35:13
Subject Length Description Subject Range Query Range Score Percent Strand
Nedd8-PB 84 CG10679-PB 1..84 1..84 424 100 Plus
Nedd8-PA 84 CG10679-PA 1..84 1..84 424 100 Plus
RpL40-PB 128 CG2960-PB 1..76 1..76 245 57.9 Plus
RpL40-PA 128 CG2960-PA 1..76 1..76 245 57.9 Plus
RpS27A-PA 156 CG5271-PA 1..76 1..76 245 57.9 Plus

IP01714.pep Sequence

Translation from 63 to 317

> IP01714.pep
MLIKVKTLTGKEIEIDIEPTDKVDRIKERVEEKEGIPPQQQRLIFSGKQM
NDDKTAADYKVQGGSVLHLVLALRGGDSILTPCV*

IP01714.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14648-PA 81 GF14648-PA 1..80 1..80 388 96.2 Plus
Dana\GF15052-PA 128 GF15052-PA 1..76 1..76 243 57.9 Plus
Dana\GF20300-PA 610 GF20300-PA 1..84 1..84 243 53.6 Plus
Dana\GF20300-PA 610 GF20300-PA 77..160 1..84 243 53.6 Plus
Dana\GF20300-PA 610 GF20300-PA 153..236 1..84 243 53.6 Plus
Dana\GF20300-PA 610 GF20300-PA 229..312 1..84 243 53.6 Plus
Dana\GF20300-PA 610 GF20300-PA 305..388 1..84 243 53.6 Plus
Dana\GF20300-PA 610 GF20300-PA 381..464 1..84 243 53.6 Plus
Dana\GF20300-PA 610 GF20300-PA 457..540 1..84 243 53.6 Plus
Dana\GF10254-PA 837 GF10254-PA 533..616 1..84 243 53.6 Plus
Dana\GF10254-PA 837 GF10254-PA 609..692 1..84 243 53.6 Plus
Dana\GF10254-PA 837 GF10254-PA 685..768 1..84 243 53.6 Plus
Dana\GF10254-PA 837 GF10254-PA 457..540 1..84 243 53.6 Plus
Dana\GF10254-PA 837 GF10254-PA 1..84 1..84 243 53.6 Plus
Dana\GF10254-PA 837 GF10254-PA 77..160 1..84 243 53.6 Plus
Dana\GF10254-PA 837 GF10254-PA 153..236 1..84 243 53.6 Plus
Dana\GF10254-PA 837 GF10254-PA 229..312 1..84 243 53.6 Plus
Dana\GF10254-PA 837 GF10254-PA 305..388 1..84 243 53.6 Plus
Dana\GF10254-PA 837 GF10254-PA 381..464 1..84 243 53.6 Plus
Dana\GF15783-PA 156 GF15783-PA 1..76 1..76 242 57.9 Plus
Dana\GF10254-PA 837 GF10254-PA 761..836 1..76 242 57.9 Plus
Dana\GF20300-PA 610 GF20300-PA 533..608 1..76 241 57.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21672-PA 84 GG21672-PA 1..84 1..84 419 97.6 Plus
Dere\GG24988-PA 128 GG24988-PA 1..76 1..76 243 57.9 Plus
Dere\GG19855-PA 328 GG19855-PA 59..142 1..84 243 53.6 Plus
Dere\GG19855-PA 328 GG19855-PA 135..218 1..84 243 53.6 Plus
Dere\GG19855-PA 328 GG19855-PA 211..294 1..84 243 53.6 Plus
Dere\GG17684-PA 534 GG17684-PA 1..84 1..84 243 53.6 Plus
Dere\GG17684-PA 534 GG17684-PA 77..160 1..84 243 53.6 Plus
Dere\GG17684-PA 534 GG17684-PA 153..236 1..84 243 53.6 Plus
Dere\GG17684-PA 534 GG17684-PA 229..312 1..84 243 53.6 Plus
Dere\GG17684-PA 534 GG17684-PA 305..388 1..84 243 53.6 Plus
Dere\GG17684-PA 534 GG17684-PA 381..464 1..84 243 53.6 Plus
Dere\GG10127-PA 156 GG10127-PA 1..76 1..76 242 57.9 Plus
Dere\GG17684-PA 534 GG17684-PA 457..532 1..76 241 57.9 Plus
Dere\GG19855-PA 328 GG19855-PA 1..66 19..84 195 51.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:25:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11603-PA 81 GH11603-PA 1..78 1..78 387 97.4 Plus
Dgri\GH10063-PA 128 GH10063-PA 1..76 1..76 243 57.9 Plus
Dgri\GH15714-PA 535 GH15714-PA 1..84 1..84 243 53.6 Plus
Dgri\GH15714-PA 535 GH15714-PA 77..160 1..84 243 53.6 Plus
Dgri\GH15714-PA 535 GH15714-PA 153..236 1..84 243 53.6 Plus
Dgri\GH15714-PA 535 GH15714-PA 229..312 1..84 243 53.6 Plus
Dgri\GH15714-PA 535 GH15714-PA 305..388 1..84 243 53.6 Plus
Dgri\GH15714-PA 535 GH15714-PA 381..464 1..84 243 53.6 Plus
Dgri\GH12661-PA 699 GH12661-PA 1..84 1..84 243 53.6 Plus
Dgri\GH12661-PA 699 GH12661-PA 77..160 1..84 243 53.6 Plus
Dgri\GH12661-PA 699 GH12661-PA 153..236 1..84 243 53.6 Plus
Dgri\GH12661-PA 699 GH12661-PA 229..312 1..84 243 53.6 Plus
Dgri\GH12661-PA 699 GH12661-PA 305..388 1..84 243 53.6 Plus
Dgri\GH12661-PA 699 GH12661-PA 381..464 1..84 243 53.6 Plus
Dgri\GH12661-PA 699 GH12661-PA 457..540 1..84 243 53.6 Plus
Dgri\GH13542-PA 156 GH13542-PA 1..76 1..76 242 57.9 Plus
Dgri\GH15714-PA 535 GH15714-PA 457..532 1..76 242 57.9 Plus
Dgri\GH12661-PA 699 GH12661-PA 533..597 1..65 194 53.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:09
Subject Length Description Subject Range Query Range Score Percent Strand
Nedd8-PB 84 CG10679-PB 1..84 1..84 424 100 Plus
Nedd8-PA 84 CG10679-PA 1..84 1..84 424 100 Plus
CG11700-PB 301 CG11700-PB 153..231 1..79 248 58.2 Plus
Ubi-p5E-PB 534 CG32744-PB 381..459 1..79 246 57 Plus
Ubi-p5E-PB 534 CG32744-PB 1..79 1..79 246 57 Plus
Ubi-p5E-PB 534 CG32744-PB 77..155 1..79 246 57 Plus
Ubi-p5E-PB 534 CG32744-PB 153..231 1..79 246 57 Plus
Ubi-p5E-PB 534 CG32744-PB 229..307 1..79 246 57 Plus
Ubi-p5E-PB 534 CG32744-PB 305..383 1..79 246 57 Plus
Ubi-p5E-PA 534 CG32744-PA 1..79 1..79 246 57 Plus
Ubi-p5E-PA 534 CG32744-PA 77..155 1..79 246 57 Plus
Ubi-p5E-PA 534 CG32744-PA 153..231 1..79 246 57 Plus
Ubi-p5E-PA 534 CG32744-PA 229..307 1..79 246 57 Plus
Ubi-p5E-PA 534 CG32744-PA 305..383 1..79 246 57 Plus
Ubi-p5E-PA 534 CG32744-PA 381..459 1..79 246 57 Plus
Ubi-p63E-PD 763 CG11624-PD 153..231 1..79 246 57 Plus
Ubi-p63E-PD 763 CG11624-PD 229..307 1..79 246 57 Plus
Ubi-p63E-PD 763 CG11624-PD 305..383 1..79 246 57 Plus
Ubi-p63E-PD 763 CG11624-PD 381..459 1..79 246 57 Plus
Ubi-p63E-PD 763 CG11624-PD 457..535 1..79 246 57 Plus
Ubi-p63E-PD 763 CG11624-PD 533..611 1..79 246 57 Plus
Ubi-p63E-PD 763 CG11624-PD 609..687 1..79 246 57 Plus
Ubi-p63E-PD 763 CG11624-PD 1..79 1..79 246 57 Plus
Ubi-p63E-PD 763 CG11624-PD 77..155 1..79 246 57 Plus
Ubi-p63E-PB 763 CG11624-PB 1..79 1..79 246 57 Plus
Ubi-p63E-PB 763 CG11624-PB 77..155 1..79 246 57 Plus
Ubi-p63E-PB 763 CG11624-PB 153..231 1..79 246 57 Plus
Ubi-p63E-PB 763 CG11624-PB 229..307 1..79 246 57 Plus
Ubi-p63E-PB 763 CG11624-PB 305..383 1..79 246 57 Plus
Ubi-p63E-PB 763 CG11624-PB 381..459 1..79 246 57 Plus
Ubi-p63E-PB 763 CG11624-PB 457..535 1..79 246 57 Plus
Ubi-p63E-PB 763 CG11624-PB 533..611 1..79 246 57 Plus
Ubi-p63E-PB 763 CG11624-PB 609..687 1..79 246 57 Plus
Ubi-p63E-PC 763 CG11624-PC 1..79 1..79 246 57 Plus
Ubi-p63E-PC 763 CG11624-PC 77..155 1..79 246 57 Plus
Ubi-p63E-PC 763 CG11624-PC 153..231 1..79 246 57 Plus
Ubi-p63E-PC 763 CG11624-PC 229..307 1..79 246 57 Plus
Ubi-p63E-PC 763 CG11624-PC 305..383 1..79 246 57 Plus
Ubi-p63E-PC 763 CG11624-PC 381..459 1..79 246 57 Plus
Ubi-p63E-PC 763 CG11624-PC 457..535 1..79 246 57 Plus
Ubi-p63E-PC 763 CG11624-PC 533..611 1..79 246 57 Plus
Ubi-p63E-PC 763 CG11624-PC 609..687 1..79 246 57 Plus
Ubi-p63E-PA 763 CG11624-PA 1..79 1..79 246 57 Plus
Ubi-p63E-PA 763 CG11624-PA 77..155 1..79 246 57 Plus
Ubi-p63E-PA 763 CG11624-PA 153..231 1..79 246 57 Plus
Ubi-p63E-PA 763 CG11624-PA 229..307 1..79 246 57 Plus
Ubi-p63E-PA 763 CG11624-PA 305..383 1..79 246 57 Plus
Ubi-p63E-PA 763 CG11624-PA 381..459 1..79 246 57 Plus
Ubi-p63E-PA 763 CG11624-PA 457..535 1..79 246 57 Plus
Ubi-p63E-PA 763 CG11624-PA 533..611 1..79 246 57 Plus
Ubi-p63E-PA 763 CG11624-PA 609..687 1..79 246 57 Plus
RpL40-PB 128 CG2960-PB 1..76 1..76 245 57.9 Plus
RpL40-PA 128 CG2960-PA 1..76 1..76 245 57.9 Plus
RpS27A-PA 156 CG5271-PA 1..76 1..76 245 57.9 Plus
Ubi-p5E-PB 534 CG32744-PB 457..532 1..76 245 57.9 Plus
Ubi-p5E-PA 534 CG32744-PA 457..532 1..76 245 57.9 Plus
Ubi-p63E-PD 763 CG11624-PD 685..760 1..76 245 57.9 Plus
Ubi-p63E-PB 763 CG11624-PB 685..760 1..76 245 57.9 Plus
Ubi-p63E-PC 763 CG11624-PC 685..760 1..76 245 57.9 Plus
Ubi-p63E-PA 763 CG11624-PA 685..760 1..76 245 57.9 Plus
CG11700-PB 301 CG11700-PB 1..79 1..79 209 48.1 Plus
CG11700-PB 301 CG11700-PB 77..155 1..79 209 48.1 Plus
CG11700-PB 301 CG11700-PB 229..296 1..68 203 52.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:25:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17172-PA 83 GI17172-PA 1..79 1..79 385 97.5 Plus
Dmoj\GI21526-PA 609 GI21526-PA 1..84 1..84 244 53.6 Plus
Dmoj\GI21526-PA 609 GI21526-PA 77..160 1..84 244 53.6 Plus
Dmoj\GI21526-PA 609 GI21526-PA 153..236 1..84 244 53.6 Plus
Dmoj\GI21526-PA 609 GI21526-PA 229..312 1..84 244 53.6 Plus
Dmoj\GI21526-PA 609 GI21526-PA 305..388 1..84 244 53.6 Plus
Dmoj\GI21526-PA 609 GI21526-PA 381..464 1..84 244 53.6 Plus
Dmoj\GI21526-PA 609 GI21526-PA 457..540 1..84 244 53.6 Plus
Dmoj\GI16482-PA 128 GI16482-PA 1..76 1..76 243 57.9 Plus
Dmoj\GI21526-PA 609 GI21526-PA 533..609 1..77 243 57.1 Plus
Dmoj\GI14272-PA 668 GI14272-PA 1..84 1..84 243 53.6 Plus
Dmoj\GI14272-PA 668 GI14272-PA 77..160 1..84 243 53.6 Plus
Dmoj\GI14272-PA 668 GI14272-PA 153..236 1..84 243 53.6 Plus
Dmoj\GI14272-PA 668 GI14272-PA 229..312 1..84 243 53.6 Plus
Dmoj\GI14272-PA 668 GI14272-PA 305..388 1..84 243 53.6 Plus
Dmoj\GI14272-PA 668 GI14272-PA 381..464 1..84 243 53.6 Plus
Dmoj\GI14272-PA 668 GI14272-PA 457..540 1..84 243 53.6 Plus
Dmoj\GI10618-PA 156 GI10618-PA 1..76 1..76 242 57.9 Plus
Dmoj\GI14272-PA 668 GI14272-PA 533..608 1..76 241 57.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19627-PA 80 GL19627-PA 1..78 1..78 389 98.7 Plus
Dper\GL13989-PA 128 GL13989-PA 1..76 1..76 243 57.9 Plus
Dper\GL20619-PA 231 GL20619-PA 1..84 1..84 243 53.6 Plus
Dper\GL14086-PA 79 GL14086-PA 1..76 1..76 242 57.9 Plus
Dper\GL18966-PA 156 GL18966-PA 1..76 1..76 242 57.9 Plus
Dper\GL20619-PA 231 GL20619-PA 154..229 1..76 241 57.9 Plus
Dper\GL20619-PA 231 GL20619-PA 101..161 24..84 175 52.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10488-PA 80 GA10488-PA 1..78 1..78 389 98.7 Plus
Dpse\GA15543-PA 128 GA15543-PA 1..76 1..76 243 57.9 Plus
Dpse\GA30006-PA 687 GA30006-PA 1..84 1..84 243 53.6 Plus
Dpse\GA30006-PA 687 GA30006-PA 77..160 1..84 243 53.6 Plus
Dpse\GA30006-PA 687 GA30006-PA 153..236 1..84 243 53.6 Plus
Dpse\GA30006-PA 687 GA30006-PA 229..312 1..84 243 53.6 Plus
Dpse\GA30006-PA 687 GA30006-PA 305..388 1..84 243 53.6 Plus
Dpse\GA30006-PA 687 GA30006-PA 381..464 1..84 243 53.6 Plus
Dpse\GA30006-PA 687 GA30006-PA 457..540 1..84 243 53.6 Plus
Dpse\GA30006-PA 687 GA30006-PA 533..616 1..84 243 53.6 Plus
Dpse\GA24218-PA 156 GA24218-PA 1..76 1..76 242 57.9 Plus
Dpse\GA30006-PA 687 GA30006-PA 609..684 1..76 242 57.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17051-PA 84 GM17051-PA 1..84 1..84 419 98.8 Plus
Dsec\GM14032-PA 915 GM14032-PA 533..616 1..84 245 53.6 Plus
Dsec\GM12582-PA 321 GM12582-PA 77..160 1..84 244 53.6 Plus
Dsec\GM12582-PA 321 GM12582-PA 153..236 1..84 244 53.6 Plus
Dsec\GM12582-PA 321 GM12582-PA 229..312 1..84 244 53.6 Plus
Dsec\GM14032-PA 915 GM14032-PA 1..84 1..84 244 53.6 Plus
Dsec\GM14032-PA 915 GM14032-PA 77..160 1..84 244 53.6 Plus
Dsec\GM14032-PA 915 GM14032-PA 153..236 1..84 244 53.6 Plus
Dsec\GM14032-PA 915 GM14032-PA 229..312 1..84 244 53.6 Plus
Dsec\GM14032-PA 915 GM14032-PA 305..388 1..84 244 53.6 Plus
Dsec\GM14032-PA 915 GM14032-PA 381..464 1..84 244 53.6 Plus
Dsec\GM14032-PA 915 GM14032-PA 457..540 1..84 244 53.6 Plus
Dsec\GM14032-PA 915 GM14032-PA 609..692 1..84 244 53.6 Plus
Dsec\GM14032-PA 915 GM14032-PA 685..768 1..84 244 53.6 Plus
Dsec\GM18458-PA 128 GM18458-PA 1..76 1..76 243 57.9 Plus
Dsec\GM18339-PA 156 GM18339-PA 1..76 1..76 242 57.9 Plus
Dsec\GM14032-PA 915 GM14032-PA 837..912 1..76 242 57.9 Plus
Dsec\GM12582-PA 321 GM12582-PA 1..84 1..84 235 52.4 Plus
Dsec\GM14032-PA 915 GM14032-PA 761..844 1..84 235 52.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21798-PA 50 GD21798-PA 1..50 1..50 244 100 Plus
Dsim\GD16200-PA 105 GD16200-PA 1..76 1..76 243 57.9 Plus
Dsim\GD12014-PA 128 GD12014-PA 1..76 1..76 243 57.9 Plus
Dsim\GD13313-PA 195 GD13313-PA 1..80 1..80 243 56.2 Plus
Dsim\GD13313-PA 195 GD13313-PA 77..156 1..80 243 56.2 Plus
Dsim\GD23696-PA 156 GD23696-PA 1..76 1..76 242 57.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:25:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17678-PA 83 GJ17678-PA 1..81 1..81 395 96.3 Plus
Dvir\GJ16068-PA 384 GJ16068-PA 1..84 1..84 244 53.6 Plus
Dvir\GJ16068-PA 384 GJ16068-PA 77..160 1..84 244 53.6 Plus
Dvir\GJ16068-PA 384 GJ16068-PA 153..236 1..84 244 53.6 Plus
Dvir\GJ16068-PA 384 GJ16068-PA 229..312 1..84 244 53.6 Plus
Dvir\GJ16220-PA 128 GJ16220-PA 1..76 1..76 243 57.9 Plus
Dvir\GJ16000-PA 457 GJ16000-PA 1..84 1..84 243 53.6 Plus
Dvir\GJ16000-PA 457 GJ16000-PA 77..160 1..84 243 53.6 Plus
Dvir\GJ16000-PA 457 GJ16000-PA 153..236 1..84 243 53.6 Plus
Dvir\GJ16000-PA 457 GJ16000-PA 229..312 1..84 243 53.6 Plus
Dvir\GJ16000-PA 457 GJ16000-PA 305..388 1..84 243 53.6 Plus
Dvir\GJ21841-PA 156 GJ21841-PA 1..76 1..76 242 57.9 Plus
Dvir\GJ16000-PA 457 GJ16000-PA 381..456 1..76 242 57.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:25:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24685-PA 78 GK24685-PA 1..76 1..76 379 98.7 Plus
Dwil\GK10077-PA 610 GK10077-PA 1..84 1..84 244 53.6 Plus
Dwil\GK10077-PA 610 GK10077-PA 77..160 1..84 244 53.6 Plus
Dwil\GK10077-PA 610 GK10077-PA 153..236 1..84 244 53.6 Plus
Dwil\GK10077-PA 610 GK10077-PA 229..312 1..84 244 53.6 Plus
Dwil\GK10077-PA 610 GK10077-PA 305..388 1..84 244 53.6 Plus
Dwil\GK10077-PA 610 GK10077-PA 381..464 1..84 244 53.6 Plus
Dwil\GK10077-PA 610 GK10077-PA 457..540 1..84 244 53.6 Plus
Dwil\GK24609-PA 128 GK24609-PA 1..76 1..76 243 57.9 Plus
Dwil\GK18589-PA 156 GK18589-PA 1..76 1..76 242 57.9 Plus
Dwil\GK10077-PA 610 GK10077-PA 533..608 1..76 242 57.9 Plus
Dwil\GK20481-PA 611 GK20481-PA 1..84 1..84 237 52.4 Plus
Dwil\GK20481-PA 611 GK20481-PA 77..160 1..84 237 52.4 Plus
Dwil\GK20481-PA 611 GK20481-PA 153..236 1..84 237 52.4 Plus
Dwil\GK20481-PA 611 GK20481-PA 229..312 1..84 237 52.4 Plus
Dwil\GK20481-PA 611 GK20481-PA 305..388 1..84 237 52.4 Plus
Dwil\GK20481-PA 611 GK20481-PA 381..464 1..84 237 52.4 Plus
Dwil\GK20481-PA 611 GK20481-PA 457..540 1..84 237 52.4 Plus
Dwil\GK20481-PA 611 GK20481-PA 533..608 1..76 234 56.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:25:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12693-PA 84 GE12693-PA 1..84 1..84 419 97.6 Plus
Dyak\RpL40-PA 128 GE18276-PA 1..76 1..76 243 57.9 Plus
Dyak\GE20668-PA 79 GE20668-PA 1..76 1..76 242 57.9 Plus
Dyak\RpS27A-PA 156 GE11312-PA 1..76 1..76 242 57.9 Plus
Dyak\GE18939-PA 156 GE18939-PA 1..76 1..76 242 57.9 Plus