Clone IP01737 Report

Search the DGRC for IP01737

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:17
Well:37
Vector:pOT2
Associated Gene/Transcriptrobl22E-RA
Protein status:IP01737.pep: gold
Preliminary Size:294
Sequenced Size:465

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10838 2005-01-01 Successful iPCR screen
robl22E 2008-04-29 Release 5.5 accounting
robl22E 2008-08-15 Release 5.9 accounting
robl22E 2008-12-18 5.12 accounting

Clone Sequence Records

IP01737.complete Sequence

465 bp (465 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023397

> IP01737.complete
ACCTTCTTTGCATCGAAATTTCTCTAATAAGGTAATCGAATAGACGCAAG
GATGTCCGCCGAAGTGGAGGAACTATTGAAGCGCTTTCAGTCCATGAAGA
ACGTCACCGGCATAGTTGTGGTGGACAACGACGGCATTCCGATCAAAACG
ACCCTGGACTACACTCTGACACTCCACTACGCGGCACTGATGCAAACGGT
GCGGGAGAAGGCTCGCCAGGTGGTCCTGGATCTGGACGCCACCAACGAAT
TCACCTTCCTGCGGCTGCGGACTGAGCAGAATGAGGTGATGCTGTGCCCG
CAGGAAGATTACTTCATCATGGTGATCCAGAGCCCGTGCGACTAGAGCAC
AATATTCCAGGCCCAAGCTCATTCCGCTGGCAATTATTTTCAGGCAGAGT
GTTCAGTAAATGTTATTAAAATACTCGGCATAGTCTCGATTTCGCAAAAA
AAAAAAAAAAAAAAA

IP01737.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
robl22E-RA 450 robl22E-RA 1..446 1..446 2230 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2289969..2290413 445..1 2225 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:32:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2290228..2290673 446..1 2230 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:43:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2290228..2290673 446..1 2230 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:17:22 has no hits.

IP01737.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:18:10 Download gff for IP01737.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2289969..2290413 1..445 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:15:37 Download gff for IP01737.complete
Subject Subject Range Query Range Percent Splice Strand
robl22E-RA 1..294 52..345 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:27:08 Download gff for IP01737.complete
Subject Subject Range Query Range Percent Splice Strand
robl22E-RA 1..294 52..345 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:12:09 Download gff for IP01737.complete
Subject Subject Range Query Range Percent Splice Strand
robl22E-RA 1..294 52..345 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:11:07 Download gff for IP01737.complete
Subject Subject Range Query Range Percent Splice Strand
robl22E-RA 1..294 52..345 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:04:05 Download gff for IP01737.complete
Subject Subject Range Query Range Percent Splice Strand
robl22E-RA 1..294 52..345 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:30:12 Download gff for IP01737.complete
Subject Subject Range Query Range Percent Splice Strand
robl22E-RA 1..294 52..345 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:27:08 Download gff for IP01737.complete
Subject Subject Range Query Range Percent Splice Strand
robl22E-RA 1..445 1..445 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:12:09 Download gff for IP01737.complete
Subject Subject Range Query Range Percent Splice Strand
robl22E-RA 26..470 1..445 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:11:07 Download gff for IP01737.complete
Subject Subject Range Query Range Percent Splice Strand
robl22E-RA 1..294 52..345 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:04:05 Download gff for IP01737.complete
Subject Subject Range Query Range Percent Splice Strand
robl22E-RA 26..470 1..445 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:18:10 Download gff for IP01737.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2290229..2290673 1..445 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:18:10 Download gff for IP01737.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2290229..2290673 1..445 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:18:10 Download gff for IP01737.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2290229..2290673 1..445 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:12:09 Download gff for IP01737.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2290229..2290673 1..445 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:47:42 Download gff for IP01737.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2290229..2290673 1..445 100   Minus

IP01737.pep Sequence

Translation from 51 to 344

> IP01737.pep
MSAEVEELLKRFQSMKNVTGIVVVDNDGIPIKTTLDYTLTLHYAALMQTV
REKARQVVLDLDATNEFTFLRLRTEQNEVMLCPQEDYFIMVIQSPCD*

IP01737.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15283-PA 97 GF15283-PA 1..97 1..97 417 77.3 Plus
Dana\GF21526-PA 97 GF21526-PA 1..97 1..97 306 55.7 Plus
Dana\GF13122-PA 97 GF13122-PA 1..97 1..97 300 54.6 Plus
Dana\GF12509-PA 141 GF12509-PA 36..128 5..97 153 31.2 Plus
Dana\GF19843-PA 133 GF19843-PA 51..123 21..93 131 32.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24530-PA 97 GG24530-PA 1..97 1..97 478 92.8 Plus
Dere\GG21468-PA 97 GG21468-PA 1..95 1..95 296 54.7 Plus
Dere\GG20680-PA 100 GG20680-PA 5..100 2..97 295 54.2 Plus
Dere\GG21147-PA 115 GG21147-PA 3..94 2..93 156 33.7 Plus
Dere\GG22008-PA 114 GG22008-PA 15..107 5..97 155 31.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13788-PA 97 GH13788-PA 1..97 1..97 355 67 Plus
Dgri\GH21399-PA 97 GH21399-PA 1..97 1..97 300 54.6 Plus
Dgri\GH20486-PA 108 GH20486-PA 16..105 5..94 155 32.2 Plus
Dgri\GH21001-PA 114 GH21001-PA 34..106 21..93 151 39.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:18
Subject Length Description Subject Range Query Range Score Percent Strand
robl22E-PB 97 CG10838-PB 1..97 1..97 491 100 Plus
robl22E-PA 97 CG10838-PA 1..97 1..97 491 100 Plus
robl-PA 97 CG10751-PA 1..97 1..97 285 54.6 Plus
CG10834-PA 97 CG10834-PA 1..95 1..95 282 53.7 Plus
CG10822-PA 114 CG10822-PA 15..107 5..97 158 31.2 Plus
robl37BC-PA 115 CG15171-PA 3..94 2..93 143 31.5 Plus
robls54B-PA 112 CG34192-PA 16..108 5..97 137 29 Plus
robls54B-PB 112 CG34192-PB 16..108 5..97 137 29 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17191-PA 97 GI17191-PA 1..97 1..97 312 59.8 Plus
Dmoj\GI18578-PA 108 GI18578-PA 13..108 2..97 295 54.2 Plus
Dmoj\GI16945-PA 110 GI16945-PA 1..84 2..85 233 52.4 Plus
Dmoj\GI21029-PA 100 GI21029-PA 8..97 5..94 154 31.1 Plus
Dmoj\GI20640-PA 116 GI20640-PA 21..109 4..93 146 33.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19405-PA 97 GL19405-PA 1..97 1..97 414 77.3 Plus
Dper\GL26110-PA 97 GL26110-PA 1..97 1..97 301 53.6 Plus
Dper\GL11426-PA 97 GL11426-PA 1..97 1..97 300 54.6 Plus
Dper\GL27334-PA 112 GL27334-PA 2..92 3..93 140 27.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10586-PA 97 GA10586-PA 1..97 1..97 414 77.3 Plus
Dpse\GA10543-PA 97 GA10543-PA 1..97 1..97 300 54.6 Plus
Dpse\GA10585-PA 97 GA10585-PA 1..97 1..97 300 53.6 Plus
Dpse\GA13548-PA 112 GA13548-PA 2..92 3..93 139 27.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18239-PA 97 GM18239-PA 1..97 1..97 498 96.9 Plus
Dsec\GM16116-PA 97 GM16116-PA 1..95 1..95 301 55.8 Plus
Dsec\GM21776-PA 97 GM21776-PA 1..97 1..97 300 54.6 Plus
Dsec\GM26651-PA 97 GM26651-PA 1..97 1..97 300 54.6 Plus
Dsec\GM21987-PA 114 GM21987-PA 15..107 5..97 157 31.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22844-PA 97 GD22844-PA 1..97 1..97 498 96.9 Plus
Dsim\GD21619-PA 97 GD21619-PA 1..95 1..95 301 55.8 Plus
Dsim\GD11269-PA 97 GD11269-PA 1..97 1..97 300 54.6 Plus
Dsim\GD11487-PA 111 GD11487-PA 15..107 5..97 157 31.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22281-PA 97 GJ22281-PA 1..97 1..97 363 66 Plus
Dvir\GJ20372-PA 97 GJ20372-PA 1..97 1..97 300 54.6 Plus
Dvir\GJ21956-PA 106 GJ21956-PA 14..105 5..96 152 29.3 Plus
Dvir\GJ21607-PA 119 GJ21607-PA 40..112 21..93 150 39.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14988-PA 97 GK14988-PA 1..97 1..97 363 69.1 Plus
Dwil\GK22899-PA 97 GK22899-PA 1..97 1..97 300 54.6 Plus
Dwil\GK18698-PA 97 GK18698-PA 1..97 1..97 295 53.6 Plus
Dwil\GK19376-PA 116 GK19376-PA 1..94 1..94 182 30.9 Plus
Dwil\GK19223-PA 113 GK19223-PA 8..100 5..97 167 33.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15136-PA 97 GE15136-PA 1..97 1..97 470 90.7 Plus
Dyak\GE11664-PA 97 GE11664-PA 1..97 1..97 300 54.6 Plus
Dyak\GE12939-PA 97 GE12939-PA 1..95 1..95 294 54.7 Plus
Dyak\GE13221-PA 115 GE13221-PA 3..94 2..93 151 33.7 Plus
Dyak\GE12086-PA 114 GE12086-PA 15..107 5..97 151 30.1 Plus

IP01737.hyp Sequence

Translation from 51 to 344

> IP01737.hyp
MSAEVEELLKRFQSMKNVTGIVVVDNDGIPIKTTLDYTLTLHYAALMQTV
REKARQVVLDLDATNEFTFLRLRTEQNEVMLCPQEDYFIMVIQSPCD*

IP01737.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:35:33
Subject Length Description Subject Range Query Range Score Percent Strand
robl22E-PB 97 CG10838-PB 1..97 1..97 491 100 Plus
robl22E-PA 97 CG10838-PA 1..97 1..97 491 100 Plus
robl-PA 97 CG10751-PA 1..97 1..97 285 54.6 Plus
CG10834-PA 97 CG10834-PA 1..95 1..95 282 53.7 Plus
CG10822-PA 114 CG10822-PA 15..107 5..97 158 31.2 Plus