Clone IP01760 Report

Search the DGRC for IP01760

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:17
Well:60
Vector:pOT2
Associated Gene/TranscriptCG11422
Protein status:IP01760.pep: Imported from assembly
Preliminary Size:530
Sequenced Size:544

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11422 2005-01-01 Successful iPCR screen
Os-E 2008-04-29 Stopped prior to 5.5

Clone Sequence Records

IP01760.complete Sequence

544 bp assembled on 2011-04-25

GenBank Submission: BT126362.1

> IP01760.complete
TCAAATACCCACTGATACTACTTTTGATTGGCTGTGCCGCTGCCCAGGAA
CCAAGGCGCGATGGAGAGTGGCCTCCGCCAGCGATTTTAAAACTGGGCAA
GCACTTCCATGACATTTGTGCTCCCAAAACTGGCGTTACTGATGAGGCCA
TCAAGGAGTTCAGCGATGGGCAAATTCATGAGGACGAGGCCCTCAAGTGC
TATATGAACTGCCTCTTCCACGAGTTCGAGGTGGTCGACGACAATGGGGA
TGTCCACATGGAGAAGGTCTTGAACGCCATTCCGGGAGAAAAGCTGAGGA
ACATTATGATGGAGGCTTCCAAGGGATGCATTCATCCTGAGGGCGACACC
CTGTGCCACAAAGCCTGGTGGTTCCACCAATGCTGGAAGAAGGCTGATCC
TGTCCACTACTTTTTGGTCTAAAGCTTTGAGAATTAAAGATATTTGAAAA
CATATATTTTTGGAACTGGTGATATTATTATAGATATTAAAATAAATAAA
TGGGAAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP01760.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1801798..1802157 503..144 1800 100 Minus
chr3R 27901430 chr3R 1797988..1798238 400..147 455 79.5 Minus
chr3R 27901430 chr3R 1802208..1802285 144..67 390 100 Minus
chr3R 27901430 chr3R 1802346..1802413 68..1 340 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:34:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5976184..5976543 503..144 1800 100 Minus
3R 32079331 3R 5972374..5972624 400..147 455 79.5 Minus
3R 32079331 3R 5976594..5976671 144..67 390 100 Minus
3R 32079331 3R 5976732..5976799 68..1 340 100 Minus
3R 32079331 3R 6206445..6206495 490..540 180 90.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:11:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5717015..5717374 503..144 1800 100 Minus
3R 31820162 3R 5717425..5717502 144..67 390 100 Minus
3R 31820162 3R 5713331..5713455 271..147 370 86.4 Minus
3R 31820162 3R 5717563..5717630 68..1 340 100 Minus
3R 31820162 3R 5713205..5713298 400..307 275 86.1 Minus
Blast to na_te.dros performed 2019-03-15 10:34:40
Subject Length Description Subject Range Query Range Score Percent Strand
Tc3 1743 Tc3 TC3 1743bp 244..305 436..494 113 69.4 Plus

IP01760.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:35:36 Download gff for IP01760.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1801833..1802156 145..468 100 <- Minus
chr3R 1802208..1802283 69..144 100 <- Minus
chr3R 1802346..1802413 1..68 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-27 15:22:43 Download gff for IP01760.complete
Subject Subject Range Query Range Percent Splice Strand
Os-E-RA 5..426 1..422 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:20:07 Download gff for IP01760.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83b-RA 5..426 1..422 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:06:45 Download gff for IP01760.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83b-RA 5..426 1..422 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-27 15:22:42 Download gff for IP01760.complete
Subject Subject Range Query Range Percent Splice Strand
Os-E-RA 19..523 1..507 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:20:07 Download gff for IP01760.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83b-RA 19..523 1..507 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:06:45 Download gff for IP01760.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83b-RA 19..523 1..507 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:35:36 Download gff for IP01760.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5976178..5976542 145..507 99 <- Minus
3R 5976594..5976669 69..144 100 <- Minus
3R 5976732..5976799 1..68 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:35:36 Download gff for IP01760.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5976178..5976542 145..507 99 <- Minus
3R 5976594..5976669 69..144 100 <- Minus
3R 5976732..5976799 1..68 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:35:36 Download gff for IP01760.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5976178..5976542 145..507 99 <- Minus
3R 5976594..5976669 69..144 100 <- Minus
3R 5976732..5976799 1..68 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:20:07 Download gff for IP01760.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1801900..1802264 145..507 99 <- Minus
arm_3R 1802316..1802391 69..144 100 <- Minus
arm_3R 1802454..1802521 1..68 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:06:26 Download gff for IP01760.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5717009..5717373 145..507 99 <- Minus
3R 5717425..5717500 69..144 100 <- Minus
3R 5717563..5717630 1..68 100   Minus

IP01760.pep Sequence

Translation from 2 to 421

> IP01760.pep
KYPLILLLIGCAAAQEPRRDGEWPPPAILKLGKHFHDICAPKTGVTDEAI
KEFSDGQIHEDEALKCYMNCLFHEFEVVDDNGDVHMEKVLNAIPGEKLRN
IMMEASKGCIHPEGDTLCHKAWWFHQCWKKADPVHYFLV*

IP01760.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:50:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18635-PA 142 GF18635-PA 7..142 4..139 655 86 Plus
Dana\GF18636-PA 150 GF18636-PA 22..149 7..138 484 67.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\Os-E-PA 142 GG10677-PA 6..142 3..139 697 92.7 Plus
Dere\Os-F-PA 154 GG10688-PA 26..153 7..138 487 68.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14293-PA 157 GH14293-PA 23..156 4..138 479 64.4 Plus
Dgri\GH14291-PA 125 GH14291-PA 10..118 23..133 327 51.4 Plus
Dgri\GH15401-PA 110 GH15401-PA 1..97 35..132 135 28.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
Obp83b-PA 141 CG11422-PA 3..141 1..139 786 100 Plus
Obp83a-PB 154 CG11421-PB 26..153 7..138 524 70.5 Plus
Obp83a-PA 154 CG11421-PA 26..153 7..138 524 70.5 Plus
Obp83a-PC 174 CG11421-PC 46..173 7..138 524 70.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23188-PA 158 GI23188-PA 31..157 8..138 469 65.6 Plus
Dmoj\GI23186-PA 149 GI23186-PA 25..149 14..139 375 53.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23490-PA 142 GL23490-PA 7..142 4..139 662 86.8 Plus
Dper\GL23491-PA 174 GL23491-PA 46..174 7..139 484 66.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:50:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp83b-PA 142 GA10996-PA 7..142 4..139 655 86 Plus
Dpse\Obp83a-PA 170 GA10995-PA 42..170 7..139 482 66.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:50:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10579-PA 141 GM10579-PA 3..141 1..139 716 95 Plus
Dsec\GM10580-PA 154 GM10580-PA 26..153 7..138 495 69.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:50:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Os-E-PA 141 GD19569-PA 3..141 1..139 716 95 Plus
Dsim\Pbprp3-PA 154 GD19570-PA 26..153 7..138 495 69.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:50:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp83a-PA 157 GJ14502-PA 20..156 4..138 480 63.8 Plus
Dvir\Obp83abL1-PA 149 GJ14501-PA 12..149 5..139 375 51.1 Plus
Dvir\Obp69a-PA 147 GJ13150-PA 28..134 25..132 143 25.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:50:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14216-PA 167 GK14216-PA 7..141 4..139 582 77.2 Plus
Dwil\GK14217-PA 165 GK14217-PA 45..164 18..138 482 71.1 Plus
Dwil\GK14215-PA 200 GK14215-PA 66..200 4..139 377 48.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24124-PA 142 GE24124-PA 7..142 4..139 694 92.6 Plus
Dyak\GE24126-PA 154 GE24126-PA 26..153 7..138 495 69.7 Plus

IP01760.hyp Sequence

Translation from 2 to 421

> IP01760.hyp
KYPLILLLIGCAAAQEPRRDGEWPPPAILKLGKHFHDICAPKTGVTDEAI
KEFSDGQIHEDEALKCYMNCLFHEFEVVDDNGDVHMEKVLNAIPGEKLRN
IMMEASKGCIHPEGDTLCHKAWWFHQCWKKADPVHYFLV*

IP01760.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
Obp83b-PA 141 CG11422-PA 3..141 1..139 786 100 Plus
Obp83a-PB 154 CG11421-PB 26..153 7..138 524 70.5 Plus
Obp83a-PA 154 CG11421-PA 26..153 7..138 524 70.5 Plus
Obp83a-PC 174 CG11421-PC 46..173 7..138 524 70.5 Plus