Clone IP01764 Report

Search the DGRC for IP01764

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:17
Well:64
Vector:pOT2
Associated Gene/TranscriptAkh-RA
Protein status:IP01764.pep: gold
Preliminary Size:240
Sequenced Size:438

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1171 2005-01-01 Successful iPCR screen
Akh 2008-04-29 Stopped prior to 5.5
Akh 2008-12-18 5.12 accounting

Clone Sequence Records

IP01764.complete Sequence

438 bp assembled on 2008-12-10

GenBank Submission: BT053704.1

> IP01764.complete
CAGAATGAATCCCAAGAGCGAAGTCCTCATTGCAGCCGTGCTCTTCATGC
TGCTGGCCTGCGTCCAGTGTCAATTGACCTTCTCGCCGGATTGGGGCAAG
CGTTCGGTGGGCGGAGCTGGTCCTGGAACCTTTTTCGAGACACAGCAGGG
CAACTGCAAGACCTCCAACGAAATGCTGCTCGAGATCTTCCGCTTCGTGC
AATCTCAGGCACAGCTCTTTCTGGACTGCAAGCACCGCGAGTAGATAGCT
GTAGGCCAACCAGATCCTGGTCCGGATCTCGGACGATGTCTAGCACGCAC
ACACATACACTCTATATATATAATTACCCGTATATACAGCACGTTATCAA
GGTAGTCGTAGTCGGCATTTAGATTTAATGGAACACTCCTTTCTCAACAA
TAAATAAGCGCATCCGAAATTAAAAAAAAAAAAAAAAA

IP01764.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
Akh-RA 610 Akh-RA 116..538 1..423 2115 100 Plus
Akh.a 1220 Akh.a 116..538 1..423 2115 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:51:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4141109..4141456 74..421 1740 100 Plus
chr3L 24539361 chr3L 4140968..4141044 1..77 370 98.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:32:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4141723..4142072 74..423 1750 100 Plus
3L 28110227 3L 4141582..4141658 1..77 370 98.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4141723..4142072 74..423 1750 100 Plus
3L 28103327 3L 4141582..4141658 1..77 370 98.7 Plus
Blast to na_te.dros performed on 2019-03-15 20:51:19 has no hits.

IP01764.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:52:16 Download gff for IP01764.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4140968..4141040 1..73 100 -> Plus
chr3L 4141109..4141456 74..421 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:08 Download gff for IP01764.complete
Subject Subject Range Query Range Percent Splice Strand
Akh-RA 1..240 5..244 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:11 Download gff for IP01764.complete
Subject Subject Range Query Range Percent Splice Strand
Akh-RA 1..240 5..244 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:26:43 Download gff for IP01764.complete
Subject Subject Range Query Range Percent Splice Strand
Akh-RA 1..240 5..244 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:33:26 Download gff for IP01764.complete
Subject Subject Range Query Range Percent Splice Strand
Akh-RA 1..240 5..244 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-10 18:14:13 Download gff for IP01764.complete
Subject Subject Range Query Range Percent Splice Strand
Akh-RA 1..240 5..244 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:11 Download gff for IP01764.complete
Subject Subject Range Query Range Percent Splice Strand
Akh-RA 116..536 1..421 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:26:43 Download gff for IP01764.complete
Subject Subject Range Query Range Percent Splice Strand
Akh-RA 116..536 1..421 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:33:26 Download gff for IP01764.complete
Subject Subject Range Query Range Percent Splice Strand
Akh-RA 116..536 1..421 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:52:16 Download gff for IP01764.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4141582..4141654 1..73 100 -> Plus
3L 4141723..4142070 74..421 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:52:16 Download gff for IP01764.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4141582..4141654 1..73 100 -> Plus
3L 4141723..4142070 74..421 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:52:16 Download gff for IP01764.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4141582..4141654 1..73 100 -> Plus
3L 4141723..4142070 74..421 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:26:43 Download gff for IP01764.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4141582..4141654 1..73 100 -> Plus
arm_3L 4141723..4142070 74..421 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:54 Download gff for IP01764.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4141723..4142070 74..421 100   Plus
3L 4141582..4141654 1..73 100 -> Plus

IP01764.hyp Sequence

Translation from 0 to 371

> IP01764.hyp
QNESQERSPHCSRALHAAGLRPVSIDLLAGLGQAFGGRSWSWNLFRDTAG
QLQDLQRNAARDLPLRAISGTALSGLQAPRVDSCRPTRSWSGSRTMSSTH
THTLYIYNYPYIQHVIKVVVVGI*
Sequence IP01764.hyp has no blast hits.

IP01764.pep Sequence

Translation from 1 to 243

> IP01764.pep
RMNPKSEVLIAAVLFMLLACVQCQLTFSPDWGKRSVGGAGPGTFFETQQG
NCKTSNEMLLEIFRFVQSQAQLFLDCKHRE*

IP01764.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10555-PA 81 GF10555-PA 1..81 2..80 271 87.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15196-PA 79 GG15196-PA 1..79 2..80 341 94.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15921-PA 87 GH15921-PA 1..87 2..80 326 80.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:44
Subject Length Description Subject Range Query Range Score Percent Strand
Akh-PA 79 CG1171-PA 1..79 2..80 418 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16573-PA 80 GI16573-PA 1..80 2..80 326 87.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12828-PA 83 GL12828-PA 1..83 2..80 289 84.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11153-PA 83 GA11153-PA 1..83 2..80 289 84.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:28:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14627-PA 79 GM14627-PA 1..79 2..80 405 96.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:28:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13816-PA 79 GD13816-PA 1..79 2..80 408 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12825-PA 84 GJ12825-PA 1..84 2..80 333 88.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12849-PA 82 GK12849-PA 1..82 2..80 331 80.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21415-PA 79 GE21415-PA 1..79 2..80 382 88.6 Plus