Clone IP01789 Report

Search the DGRC for IP01789

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:17
Well:89
Vector:pOT2
Associated Gene/TranscriptAcp62F-RA
Protein status:IP01789.pep: validated not full length
Preliminary Size:521
Sequenced Size:471

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1262 2005-01-01 Successful iPCR screen
Acp62F 2008-04-29 Release 5.5 accounting
Acp62F 2008-12-18 5.12 accounting

Clone Sequence Records

IP01789.complete Sequence

471 bp (471 high quality bases) assembled on 2006-05-24

GenBank Submission: BT025809

> IP01789.complete
CGGACATGTGGAGCTTGAAGATCTGTGCCTGTCTGGGCCTTCTATTACTT
TTCAAACCCATCGACTCCATGGGATGGCAAGGACCTAAAGTTGACTGTAC
GGCCAACGGAACTCAGACGGAGTGTCCTGTAGCATGTCCTGAAACCTGCG
AGTACTCCGGCAATGGACCCTGCGTCAAGATGTGCGGAGCTCCTTGTGTG
TGTAAGCCGGGATATGTTATCAATGAGAGGATTCCGGCCTGTGTTCTGCG
ATCCGATTGCCCAAAAGATGTTGTTCGAAAGGAAGATATGCTACTGGGTG
TATCGAACTTTAAGTGCTTTAGCAGAAATTACAACTGTTCATAGAAATTT
ATTAGGAAGGCAGCTAAACTTTAAACTAAATTACAATAAAATGTAAATAA
ATGTGTAGTAAATTACAAGCTATAATTACAAGATAATTACAAATAGTAAA
AGAAAAAAAAAAAAAAAAAAA

IP01789.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:17:28
Subject Length Description Subject Range Query Range Score Percent Strand
Acp62F-RA 479 Acp62F-RA 28..479 1..452 2260 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:42:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2739158..2739609 1..452 2245 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:32:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2739777..2740231 1..455 2275 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:10:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2739777..2740231 1..455 2275 100 Plus
Blast to na_te.dros performed 2019-03-16 02:42:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\BuT2 2775 Dbuz\BuT2 BUT2 2775bp 254..352 345..442 114 58.6 Plus
P-element 2907 P-element PPI251 2907bp AKA(V01520,X69493) Derived from X06779 (g58305) (Rel. 49, Last updated, Version 8). 2433..2539 347..452 109 58.3 Plus
Circe 7450 Circe CIRC 7450bp 6787..6869 445..365 104 63.5 Minus

IP01789.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:43:15 Download gff for IP01789.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2739158..2739609 1..452 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:15:47 Download gff for IP01789.complete
Subject Subject Range Query Range Percent Splice Strand
Acp62F-RA 5..348 1..344 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:30:27 Download gff for IP01789.complete
Subject Subject Range Query Range Percent Splice Strand
Acp62F-RA 5..348 1..344 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:14:09 Download gff for IP01789.complete
Subject Subject Range Query Range Percent Splice Strand
Acp62F-RA 5..348 1..344 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:01:27 Download gff for IP01789.complete
Subject Subject Range Query Range Percent Splice Strand
Acp62F-RA 5..348 1..344 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:17:19 Download gff for IP01789.complete
Subject Subject Range Query Range Percent Splice Strand
Acp62F-RA 5..348 1..344 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:01:44 Download gff for IP01789.complete
Subject Subject Range Query Range Percent Splice Strand
Acp62F-RA 28..479 1..452 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:30:27 Download gff for IP01789.complete
Subject Subject Range Query Range Percent Splice Strand
Acp62F-RA 28..479 1..452 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:14:09 Download gff for IP01789.complete
Subject Subject Range Query Range Percent Splice Strand
Acp62F-RA 28..479 1..452 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:01:27 Download gff for IP01789.complete
Subject Subject Range Query Range Percent Splice Strand
Acp62F-RA 28..422 1..395 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:17:19 Download gff for IP01789.complete
Subject Subject Range Query Range Percent Splice Strand
Acp62F-RA 28..479 1..452 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:43:15 Download gff for IP01789.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2739777..2740228 1..452 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:43:15 Download gff for IP01789.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2739777..2740228 1..452 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:43:15 Download gff for IP01789.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2739777..2740228 1..452 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:14:09 Download gff for IP01789.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2739777..2740228 1..452 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:56:02 Download gff for IP01789.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2739777..2740228 1..452 100   Plus

IP01789.pep Sequence

Translation from 2 to 343

> IP01789.pep
DMWSLKICACLGLLLLFKPIDSMGWQGPKVDCTANGTQTECPVACPETCE
YSGNGPCVKMCGAPCVCKPGYVINERIPACVLRSDCPKDVVRKEDMLLGV
SNFKCFSRNYNCS*

IP01789.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20050-PA 106 GF20050-PA 4..97 11..106 180 43.8 Plus
Dana\GF19794-PA 128 GF19794-PA 11..107 13..106 142 35.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14885-PA 131 GG14885-PA 6..109 4..112 378 67 Plus
Dere\GG15894-PA 120 GG15894-PA 24..108 29..113 245 55.8 Plus
Dere\GG20624-PA 200 GG20624-PA 115..198 18..100 150 43.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23083-PA 113 GH23083-PA 36..107 25..95 140 43.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
Acp62F-PA 115 CG1262-PA 3..115 1..113 647 100 Plus
CG33259-PA 119 CG33259-PA 24..107 29..113 301 60 Plus
CG5267-PB 201 CG5267-PB 129..194 29..95 181 50.7 Plus
CG34189-PA 122 CG34189-PA 53..110 32..90 170 47.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\Acp62F-PA 135 GL11209-PA 12..104 7..106 187 43 Plus
Dper\GL11791-PA 113 GL11791-PA 26..106 28..110 149 42.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Acp62F-PA 135 GA24640-PA 12..104 7..106 192 43 Plus
Dpse\GA24074-PA 113 GA24074-PA 26..106 28..110 144 42.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Acp62F-PA 117 GM14509-PA 3..114 1..112 476 83 Plus
Dsec\GM25525-PA 117 GM25525-PA 9..107 14..113 258 49 Plus
Dsec\GM21718-PA 200 GM21718-PA 128..198 29..100 152 48.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Acp62F-PA 117 GD13705-PA 3..114 1..112 516 88.4 Plus
Dsim\GD14540-PA 118 GD14540-PA 9..107 14..113 263 50 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20998-PA 107 GJ20998-PA 31..99 25..94 131 40 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18908-PA 97 GK18908-PA 7..82 14..93 163 46.9 Plus
Dwil\GK19009-PA 106 GK19009-PA 37..104 32..100 142 44.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:54:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20336-PA 118 GE20336-PA 6..109 4..112 395 73.4 Plus
Dyak\GE22237-PA 120 GE22237-PA 1..107 2..112 227 43.8 Plus
Dyak\GE23139-PA 120 GE23139-PA 1..107 2..112 227 43.8 Plus
Dyak\GE11814-PA 198 GE11814-PA 129..196 32..100 147 47.8 Plus

IP01789.hyp Sequence

Translation from 2 to 343

> IP01789.hyp
DMWSLKICACLGLLLLFKPIDSMGWQGPKVDCTANGTQTECPVACPETCE
YSGNGPCVKMCGAPCVCKPGYVINERIPACVLRSDCPKDVVRKEDMLLGV
SNFKCFSRNYNCS*

IP01789.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
Acp62F-PA 115 CG1262-PA 3..115 1..113 647 100 Plus
CG33259-PA 119 CG33259-PA 24..107 29..113 301 60 Plus
CG5267-PA 178 CG5267-PA 106..171 29..95 181 50.7 Plus
CG34189-PA 122 CG34189-PA 53..110 32..90 170 47.5 Plus