BDGP Sequence Production Resources |
Search the DGRC for IP01789
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 17 |
Well: | 89 |
Vector: | pOT2 |
Associated Gene/Transcript | Acp62F-RA |
Protein status: | IP01789.pep: validated not full length |
Preliminary Size: | 521 |
Sequenced Size: | 471 |
Gene | Date | Evidence |
---|---|---|
CG1262 | 2005-01-01 | Successful iPCR screen |
Acp62F | 2008-04-29 | Release 5.5 accounting |
Acp62F | 2008-12-18 | 5.12 accounting |
471 bp (471 high quality bases) assembled on 2006-05-24
GenBank Submission: BT025809
> IP01789.complete CGGACATGTGGAGCTTGAAGATCTGTGCCTGTCTGGGCCTTCTATTACTT TTCAAACCCATCGACTCCATGGGATGGCAAGGACCTAAAGTTGACTGTAC GGCCAACGGAACTCAGACGGAGTGTCCTGTAGCATGTCCTGAAACCTGCG AGTACTCCGGCAATGGACCCTGCGTCAAGATGTGCGGAGCTCCTTGTGTG TGTAAGCCGGGATATGTTATCAATGAGAGGATTCCGGCCTGTGTTCTGCG ATCCGATTGCCCAAAAGATGTTGTTCGAAAGGAAGATATGCTACTGGGTG TATCGAACTTTAAGTGCTTTAGCAGAAATTACAACTGTTCATAGAAATTT ATTAGGAAGGCAGCTAAACTTTAAACTAAATTACAATAAAATGTAAATAA ATGTGTAGTAAATTACAAGCTATAATTACAAGATAATTACAAATAGTAAA AGAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Acp62F-RA | 479 | Acp62F-RA | 28..479 | 1..452 | 2260 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 2739158..2739609 | 1..452 | 2245 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 2739777..2740231 | 1..455 | 2275 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 2739777..2740231 | 1..455 | 2275 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dbuz\BuT2 | 2775 | Dbuz\BuT2 BUT2 2775bp | 254..352 | 345..442 | 114 | 58.6 | Plus |
P-element | 2907 | P-element PPI251 2907bp AKA(V01520,X69493) Derived from X06779 (g58305) (Rel. 49, Last updated, Version 8). | 2433..2539 | 347..452 | 109 | 58.3 | Plus |
Circe | 7450 | Circe CIRC 7450bp | 6787..6869 | 445..365 | 104 | 63.5 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 2739158..2739609 | 1..452 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Acp62F-RA | 5..348 | 1..344 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Acp62F-RA | 5..348 | 1..344 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Acp62F-RA | 5..348 | 1..344 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Acp62F-RA | 5..348 | 1..344 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Acp62F-RA | 5..348 | 1..344 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Acp62F-RA | 28..479 | 1..452 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Acp62F-RA | 28..479 | 1..452 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Acp62F-RA | 28..479 | 1..452 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Acp62F-RA | 28..422 | 1..395 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Acp62F-RA | 28..479 | 1..452 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 2739777..2740228 | 1..452 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 2739777..2740228 | 1..452 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 2739777..2740228 | 1..452 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 2739777..2740228 | 1..452 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 2739777..2740228 | 1..452 | 100 | Plus |
Translation from 2 to 343
> IP01789.pep DMWSLKICACLGLLLLFKPIDSMGWQGPKVDCTANGTQTECPVACPETCE YSGNGPCVKMCGAPCVCKPGYVINERIPACVLRSDCPKDVVRKEDMLLGV SNFKCFSRNYNCS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20050-PA | 106 | GF20050-PA | 4..97 | 11..106 | 180 | 43.8 | Plus |
Dana\GF19794-PA | 128 | GF19794-PA | 11..107 | 13..106 | 142 | 35.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14885-PA | 131 | GG14885-PA | 6..109 | 4..112 | 378 | 67 | Plus |
Dere\GG15894-PA | 120 | GG15894-PA | 24..108 | 29..113 | 245 | 55.8 | Plus |
Dere\GG20624-PA | 200 | GG20624-PA | 115..198 | 18..100 | 150 | 43.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH23083-PA | 113 | GH23083-PA | 36..107 | 25..95 | 140 | 43.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Acp62F-PA | 115 | CG1262-PA | 3..115 | 1..113 | 647 | 100 | Plus |
CG33259-PA | 119 | CG33259-PA | 24..107 | 29..113 | 301 | 60 | Plus |
CG5267-PB | 201 | CG5267-PB | 129..194 | 29..95 | 181 | 50.7 | Plus |
CG34189-PA | 122 | CG34189-PA | 53..110 | 32..90 | 170 | 47.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\Acp62F-PA | 135 | GL11209-PA | 12..104 | 7..106 | 187 | 43 | Plus |
Dper\GL11791-PA | 113 | GL11791-PA | 26..106 | 28..110 | 149 | 42.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\Acp62F-PA | 135 | GA24640-PA | 12..104 | 7..106 | 192 | 43 | Plus |
Dpse\GA24074-PA | 113 | GA24074-PA | 26..106 | 28..110 | 144 | 42.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\Acp62F-PA | 117 | GM14509-PA | 3..114 | 1..112 | 476 | 83 | Plus |
Dsec\GM25525-PA | 117 | GM25525-PA | 9..107 | 14..113 | 258 | 49 | Plus |
Dsec\GM21718-PA | 200 | GM21718-PA | 128..198 | 29..100 | 152 | 48.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\Acp62F-PA | 117 | GD13705-PA | 3..114 | 1..112 | 516 | 88.4 | Plus |
Dsim\GD14540-PA | 118 | GD14540-PA | 9..107 | 14..113 | 263 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20998-PA | 107 | GJ20998-PA | 31..99 | 25..94 | 131 | 40 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18908-PA | 97 | GK18908-PA | 7..82 | 14..93 | 163 | 46.9 | Plus |
Dwil\GK19009-PA | 106 | GK19009-PA | 37..104 | 32..100 | 142 | 44.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20336-PA | 118 | GE20336-PA | 6..109 | 4..112 | 395 | 73.4 | Plus |
Dyak\GE22237-PA | 120 | GE22237-PA | 1..107 | 2..112 | 227 | 43.8 | Plus |
Dyak\GE23139-PA | 120 | GE23139-PA | 1..107 | 2..112 | 227 | 43.8 | Plus |
Dyak\GE11814-PA | 198 | GE11814-PA | 129..196 | 32..100 | 147 | 47.8 | Plus |
Translation from 2 to 343
> IP01789.hyp DMWSLKICACLGLLLLFKPIDSMGWQGPKVDCTANGTQTECPVACPETCE YSGNGPCVKMCGAPCVCKPGYVINERIPACVLRSDCPKDVVRKEDMLLGV SNFKCFSRNYNCS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Acp62F-PA | 115 | CG1262-PA | 3..115 | 1..113 | 647 | 100 | Plus |
CG33259-PA | 119 | CG33259-PA | 24..107 | 29..113 | 301 | 60 | Plus |
CG5267-PA | 178 | CG5267-PA | 106..171 | 29..95 | 181 | 50.7 | Plus |
CG34189-PA | 122 | CG34189-PA | 53..110 | 32..90 | 170 | 47.5 | Plus |