Clone IP01814 Report

Search the DGRC for IP01814

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:18
Well:14
Vector:pOT2
Associated Gene/TranscriptUbc84D-RA
Protein status:IP01814.pep: gold
Preliminary Size:462
Sequenced Size:659

Clone Sequence Records

IP01814.complete Sequence

659 bp assembled on 2009-06-08

GenBank Submission: BT088773.1

> IP01814.complete
CAATAGGAAAATTAAATTTTTAGACTTTTTTAAATTAACAAGTTTTTTTC
CGAGATCTAGGGAAAACAAAGGAAAGGAACTCTGATCCCGTTGATAGAAT
GGCTGCCACTCGTCGTCTGACACGGGAACTCTCCGATCTGGTTGAGGCCA
AGATGAGCACTCTGCGCAACATCGAGAGTAGCGATGAGTCCCTGCTGATG
TGGACGGGTCTTTTGGTTCCGGAAAAGGCGCCCTACAACAAGGGCGCCTT
CCGCATCGAAATCAACTTCCCGCCCCAGTATCCCTTTATGCCACCAAAGA
TCCTATTCAAGACGAAAATCTATCACCCCAACGTGGATGAGAAGGGGGAG
GTGTGCCTGCCCATCATCAGCACAGACAACTGGAAGCCCACAACGCGCAC
AGAGCAGGTGCTCCAGGCCCTGGTAGCCATCGTCCACAACCCGGAGCCAG
AACATCCGCTTCGTTCTGACCTGGCCGAGGAGTTCGTAAGGGAGCACAAG
AAGTTCATGAAGACGGCCGAAGAGTTCACCAAGAAGAATGCGGAGAAGCG
ACCAGAGTGAAGTCAGCCGCAGCTCACATTTATTTGTATATCAAAATTAT
ATATAGTTTGGACCATCAATTAAAACTTGTCAGACATAAAAAAAAAAAAA
AAAAAAAAA

IP01814.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:31:26
Subject Length Description Subject Range Query Range Score Percent Strand
Ubc84D-RA 462 Ubc84D-RA 1..462 99..560 2310 100 Plus
UbcD10-RA 1003 UbcD10-RA 400..745 191..536 440 75.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3344895..3345531 637..1 3170 99.8 Minus
chr2R 21145070 chr2R 13675818..13676163 536..191 440 75.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:32:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7518818..7519456 639..1 3195 100 Minus
2R 25286936 2R 17788665..17789010 536..191 440 75.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7259649..7260287 639..1 3195 100 Minus
2R 25260384 2R 17789864..17790082 536..318 285 75.3 Minus
2R 25260384 2R 17790099..17790209 301..191 210 79.2 Minus
Blast to na_te.dros performed 2019-03-17 00:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
blood 7410 blood BLOOD 7410bp 1588..1615 606..579 113 89.3 Minus

IP01814.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:15:34 Download gff for IP01814.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3344895..3345531 1..637 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:05 Download gff for IP01814.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc84D-RA 1..462 99..560 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:47:04 Download gff for IP01814.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc84D-RA 1..462 99..560 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:34:16 Download gff for IP01814.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc84D-RA 1..462 99..560 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:16:24 Download gff for IP01814.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc84D-RA 1..462 99..560 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-08 14:18:12 Download gff for IP01814.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc84D-RA 1..462 99..560 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:47:03 Download gff for IP01814.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc84D-RA 1..637 1..637 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:34:16 Download gff for IP01814.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc84D-RA 1..637 1..637 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:16:24 Download gff for IP01814.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc84D-RA 1..637 1..637 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:15:34 Download gff for IP01814.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7518820..7519456 1..637 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:15:34 Download gff for IP01814.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7518820..7519456 1..637 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:15:34 Download gff for IP01814.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7518820..7519456 1..637 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:34:16 Download gff for IP01814.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3344542..3345178 1..637 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:22:28 Download gff for IP01814.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7259651..7260287 1..637 100   Minus

IP01814.pep Sequence

Translation from 98 to 559

> IP01814.pep
MAATRRLTRELSDLVEAKMSTLRNIESSDESLLMWTGLLVPEKAPYNKGA
FRIEINFPPQYPFMPPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTR
TEQVLQALVAIVHNPEPEHPLRSDLAEEFVREHKKFMKTAEEFTKKNAEK
RPE*

IP01814.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17299-PA 153 GF17299-PA 1..153 1..153 754 91.5 Plus
Dana\GF13219-PA 154 GF13219-PA 1..152 1..152 583 67.1 Plus
Dana\GF24708-PA 180 GF24708-PA 9..161 1..152 385 45.8 Plus
Dana\GF10262-PA 350 GF10262-PA 179..325 2..149 258 34.9 Plus
Dana\GF18131-PA 147 GF18131-PA 2..146 3..148 250 32.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25139-PA 153 GG25139-PA 1..153 1..153 802 99.3 Plus
Dere\GG21014-PA 154 GG21014-PA 1..152 1..152 578 66.4 Plus
Dere\GG14153-PA 180 GG14153-PA 9..161 1..152 361 42.5 Plus
Dere\GG21088-PA 147 GG21088-PA 2..146 3..148 250 32.2 Plus
Dere\GG17819-PA 151 GG17819-PA 6..148 5..148 227 30.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19270-PA 152 GH19270-PA 1..152 1..152 679 80.3 Plus
Dgri\GH19845-PA 154 GH19845-PA 1..152 1..152 588 66.4 Plus
Dgri\GH15783-PA 180 GH15783-PA 8..162 1..152 369 42.6 Plus
Dgri\GH14086-PA 147 GH14086-PA 2..146 3..148 250 32.2 Plus
Dgri\GH22592-PA 151 GH22592-PA 6..148 5..148 228 30.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
Ubc84D-PA 153 CG12799-PA 1..153 1..153 802 100 Plus
Ubc10-PA 154 CG5788-PA 1..152 1..152 581 66.4 Plus
CG17030-PA 180 CG17030-PA 9..161 1..152 358 41.8 Plus
eff-PC 147 CG7425-PC 2..146 3..148 247 32.2 Plus
eff-PB 147 CG7425-PB 2..146 3..148 247 32.2 Plus
eff-PA 147 CG7425-PA 2..146 3..148 247 32.2 Plus
ben-PE 151 CG18319-PE 6..148 5..148 234 30.6 Plus
ben-PD 151 CG18319-PD 6..148 5..148 234 30.6 Plus
ben-PB 151 CG18319-PB 6..148 5..148 234 30.6 Plus
ben-PC 151 CG18319-PC 6..148 5..148 234 30.6 Plus
ben-PA 151 CG18319-PA 6..148 5..148 234 30.6 Plus
CG3473-PB 151 CG3473-PB 3..148 2..148 227 33.6 Plus
CG3473-PA 151 CG3473-PA 3..148 2..148 227 33.6 Plus
Ubc2-PD 232 CG6720-PD 113..231 30..148 217 33.3 Plus
Ubc2-PC 232 CG6720-PC 113..231 30..148 217 33.3 Plus
Ubc2-PB 232 CG6720-PB 113..231 30..148 217 33.3 Plus
Ubc2-PA 232 CG6720-PA 113..231 30..148 217 33.3 Plus
CG10862-PA 354 CG10862-PA 212..354 6..149 217 33.1 Plus
CG5440-PC 169 CG5440-PC 21..167 2..149 214 27.5 Plus
CG5440-PB 169 CG5440-PB 21..167 2..149 214 27.5 Plus
CG2574-PA 239 CG2574-PA 91..204 32..145 207 35.7 Plus
Ubc6-PC 151 CG2013-PC 5..146 3..142 201 30.6 Plus
Ubc6-PA 151 CG2013-PA 5..146 3..142 201 30.6 Plus
Ubc87F-PA 168 CG9602-PA 4..166 1..150 200 25.8 Plus
Ubc4-PC 199 CG8284-PC 5..153 3..148 195 32.7 Plus
Ubc4-PB 199 CG8284-PB 5..153 3..148 195 32.7 Plus
Ubc4-PA 199 CG8284-PA 5..153 3..148 195 32.7 Plus
CG40045-PA 168 CG40045-PA 32..166 29..150 190 25.9 Plus
vih-PA 178 CG10682-PA 32..177 2..149 188 28.5 Plus
CG40045-PD 167 CG40045-PD 32..165 29..150 185 24.6 Plus
CG40045-PC 132 CG40045-PC 1..130 33..150 184 25.4 Plus
CG7656-PF 317 CG7656-PF 40..182 2..131 183 28 Plus
CG7656-PA 317 CG7656-PA 40..182 2..131 183 28 Plus
CG7656-PE 319 CG7656-PE 40..182 2..131 183 28 Plus
CG7656-PD 319 CG7656-PD 40..182 2..131 183 28 Plus
CG8188-PD 209 CG8188-PD 17..160 5..149 178 25.5 Plus
CG8188-PC 209 CG8188-PC 17..160 5..149 178 25.5 Plus
CG8188-PB 209 CG8188-PB 17..160 5..149 178 25.5 Plus
CG8188-PA 209 CG8188-PA 17..160 5..149 178 25.5 Plus
morgue-PA 491 CG15437-PA 373..483 38..148 171 32.4 Plus
UbcE2M-PC 181 CG7375-PC 26..157 2..136 169 28.8 Plus
UbcE2M-PB 181 CG7375-PB 26..157 2..136 169 28.8 Plus
UbcE2M-PA 181 CG7375-PA 26..157 2..136 169 28.8 Plus
UbcE2H-PB 183 CG2257-PB 6..149 2..148 169 28.2 Plus
UbcE2H-PC 183 CG2257-PC 6..149 2..148 169 28.2 Plus
UbcE2H-PA 183 CG2257-PA 6..149 2..148 169 28.2 Plus
Ubc7-PB 167 CG4443-PB 4..161 2..146 165 25.9 Plus
Ubc7-PA 167 CG4443-PA 4..161 2..146 165 25.9 Plus
lwr-PD 159 CG3018-PD 37..146 31..138 146 24.5 Plus
lwr-PC 159 CG3018-PC 37..146 31..138 146 24.5 Plus
lwr-PB 159 CG3018-PB 37..146 31..138 146 24.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:47:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23479-PA 153 GI23479-PA 1..153 1..153 698 80.4 Plus
Dmoj\GI20435-PA 154 GI20435-PA 1..152 1..152 588 66.4 Plus
Dmoj\GI12563-PA 179 GI12563-PA 8..160 1..152 362 39.9 Plus
Dmoj\GI10619-PA 147 GI10619-PA 2..146 3..148 250 32.2 Plus
Dmoj\GI22711-PA 151 GI22711-PA 6..148 5..148 228 30.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:47:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17270-PA 154 GL17270-PA 1..152 1..152 586 67.1 Plus
Dper\GL12172-PA 154 GL12172-PA 1..153 1..152 586 71.2 Plus
Dper\GL23670-PA 147 GL23670-PA 2..146 3..148 250 32.2 Plus
Dper\GL14825-PA 151 GL14825-PA 6..148 5..148 227 30.6 Plus
Dper\GL22516-PA 220 GL22516-PA 64..208 3..149 223 31.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:47:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26215-PA 154 GA26215-PA 1..153 1..152 589 71.9 Plus
Dpse\GA19129-PA 154 GA19129-PA 1..152 1..152 586 67.1 Plus
Dpse\GA28328-PA 217 GA28328-PA 63..198 17..152 364 45.6 Plus
Dpse\GA26693-PA 147 GA26693-PA 2..146 3..148 250 32.2 Plus
Dpse\GA14886-PA 151 GA14886-PA 6..148 5..148 227 30.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10475-PA 153 GM10475-PA 1..153 1..153 797 98.7 Plus
Dsec\GM19945-PA 154 GM19945-PA 1..152 1..152 571 65.8 Plus
Dsec\GM23061-PA 154 GM23061-PA 1..152 1..152 534 61.8 Plus
Dsec\GM13939-PA 180 GM13939-PA 9..161 1..152 357 41.8 Plus
Dsec\GM25828-PA 147 GM25828-PA 2..146 3..148 250 32.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19477-PA 153 GD19477-PA 1..153 1..153 797 98.7 Plus
Dsim\GD25436-PA 154 GD25436-PA 1..152 1..152 571 65.8 Plus
Dsim\GD17512-PA 154 GD17512-PA 1..152 1..152 538 61.8 Plus
Dsim\GD13222-PA 180 GD13222-PA 9..161 1..152 357 41.8 Plus
Dsim\GD13221-PA 162 GD13221-PA 9..155 1..146 344 41.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:47:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10233-PA 153 GJ10233-PA 1..153 1..153 710 83 Plus
Dvir\GJ20107-PA 154 GJ20107-PA 1..152 1..152 588 66.4 Plus
Dvir\GJ15466-PA 178 GJ15466-PA 8..160 1..152 365 42.5 Plus
Dvir\GJ22971-PA 147 GJ22971-PA 2..146 3..148 250 32.2 Plus
Dvir\GJ23435-PA 151 GJ23435-PA 6..148 5..148 228 30.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:47:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11079-PA 153 GK11079-PA 1..153 1..153 664 78.4 Plus
Dwil\GK22072-PA 154 GK22072-PA 1..152 1..152 592 67.1 Plus
Dwil\GK17587-PA 158 GK17587-PA 8..152 1..144 364 44.8 Plus
Dwil\GK16336-PA 241 GK16336-PA 92..239 2..150 258 34.7 Plus
Dwil\GK11688-PA 147 GK11688-PA 2..146 3..148 250 32.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:47:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25785-PA 153 GE25785-PA 1..153 1..153 799 98.7 Plus
Dyak\UbcD10-PA 154 GE13957-PA 1..152 1..152 581 66.4 Plus
Dyak\GE20579-PA 180 GE20579-PA 9..161 1..152 366 43.8 Plus
Dyak\eff-PA 147 GE26430-PA 2..146 3..148 250 32.2 Plus
Dyak\GE17114-PA 151 GE17114-PA 6..148 5..148 227 30.6 Plus

IP01814.hyp Sequence

Translation from 98 to 559

> IP01814.hyp
MAATRRLTRELSDLVEAKMSTLRNIESSDESLLMWTGLLVPEKAPYNKGA
FRIEINFPPQYPFMPPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTR
TEQVLQALVAIVHNPEPEHPLRSDLAEEFVREHKKFMKTAEEFTKKNAEK
RPE*

IP01814.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:37:33
Subject Length Description Subject Range Query Range Score Percent Strand
Ubc84D-PA 153 CG12799-PA 1..153 1..153 802 100 Plus
Ubc10-PA 154 CG5788-PA 1..152 1..152 581 66.4 Plus
CG17030-PA 180 CG17030-PA 9..161 1..152 358 41.8 Plus
eff-PC 147 CG7425-PC 2..146 3..148 247 32.2 Plus
eff-PB 147 CG7425-PB 2..146 3..148 247 32.2 Plus