Clone IP01817 Report

Search the DGRC for IP01817

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:18
Well:17
Vector:pOT2
Associated Gene/TranscriptTsp42Er-RA
Protein status:IP01817.pep: gold
Preliminary Size:636
Sequenced Size:849

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12837 2005-01-01 Successful iPCR screen
Tsp42Er 2008-04-29 Release 5.5 accounting
Tsp42Er 2008-08-15 Release 5.9 accounting
Tsp42Er 2008-12-18 5.12 accounting

Clone Sequence Records

IP01817.complete Sequence

849 bp (849 high quality bases) assembled on 2006-06-07

GenBank Submission: BT025888

> IP01817.complete
TCTAGGAGTAACCATCGAAATAAAAATTAGTAACTACTGAAAAAACGAGC
ACGCGTAGTCGAATTGCTATTTACGCCATGGGTTGGTCACCGCTGATGAT
AAGGTATCTGGCATTCCTCTTCAATTTTCTTTGTGCGGTCCTGGGCATCG
CCACTATTGTGGTCAATGTAATAGCAATCGATCAAATAGCTCCAAAGGAC
CAACTCATCCTGGGACTGTACATTGCCGTTGGGTCCATCGTCTTCTTGCT
CTCATTTTTTGGATGCTTTGGTGCCATTAAGGAGAGCATCTGTGTTACCT
GGGCGTATGCCACCTCGATGCTGGTAATGCTGATCGTCTCAATAGTCATG
CTTTTTGTCTTCCGTATGCATTTCGAAGAAGACTCCATTACCAAGCTGAA
ACAAGCCTTTGCCAAGCAGACAAACACTTTCGACGCAATGGCCGAGTACC
AGACACAGTACCAGTGCTGTGGCATATACAAGTTAAAGGACTATGGAGAC
GCCTACATAACTGTTCCAAGTAGCTGTTATGACCAAAATGATACGCCCTA
CAGAGACGGTTGTCTGGCCAAAATGGAGACCCAGTACGAGGAGCTCCTCA
AGGGTCCTAAGATTGTTGGCTGGATGCTGATGGTCATTGAGATAGGTGCC
TTCACTTTCTCCACAATCATGGGAGTGTCCTTAAGGAACGAACTACGACG
CTCTGCGTATTGAACCATCGCATGATTAATATTATTAATAATAGTAGTAG
AAGGTCTTGTATATATGTACATACACATTTGTGAATTCTTTTTTTTTTTT
GATACCTGAAATATAAAATTTTAAGTAAAATAAAAAAAAAAAAAAAAAA

IP01817.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42Er-RA 965 Tsp42Er-RA 126..965 1..840 4185 99.8 Plus
Tsp42Er.a 827 Tsp42Er.a 1..827 1..831 4070 99.5 Plus
Tsp42Er.b 763 Tsp42Er.b 69..763 137..831 3475 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:50:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2953085..2953270 456..641 915 99.5 Plus
chr2R 21145070 chr2R 2953326..2953514 640..831 865 97.9 Plus
chr2R 21145070 chr2R 2952535..2952703 137..305 845 100 Plus
chr2R 21145070 chr2R 2952763..2952916 305..458 770 100 Plus
chr2R 21145070 chr2R 2951820..2951958 1..139 695 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:32:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:50:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7065922..7066122 640..840 990 99.5 Plus
2R 25286936 2R 7065681..7065866 456..641 930 100 Plus
2R 25286936 2R 7065131..7065299 137..305 845 100 Plus
2R 25286936 2R 7065359..7065512 305..458 770 100 Plus
2R 25286936 2R 7064416..7064554 1..139 695 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7067121..7067321 640..840 990 99.5 Plus
2R 25260384 2R 7066880..7067065 456..641 930 100 Plus
2R 25260384 2R 7066330..7066498 137..305 845 100 Plus
2R 25260384 2R 7066558..7066711 305..458 770 100 Plus
2R 25260384 2R 7065615..7065753 1..139 695 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:50:30 has no hits.

IP01817.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:51:24 Download gff for IP01817.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2953088..2953270 459..641 99 -> Plus
chr2R 2953328..2953490 642..807 98 -> Plus
chr2R 2951820..2951956 1..137 100 -> Plus
chr2R 2952536..2952703 138..305 100 -> Plus
chr2R 2952764..2952916 306..458 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:15:49 Download gff for IP01817.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Er-RA 1..636 78..713 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:22:44 Download gff for IP01817.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Er-RA 1..636 78..713 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:10:29 Download gff for IP01817.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Er-RA 1..636 78..713 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:41:28 Download gff for IP01817.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Er-RA 1..636 78..713 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:09:12 Download gff for IP01817.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Er-RA 1..636 78..713 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:51:07 Download gff for IP01817.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Er-RA 1..831 1..831 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:22:44 Download gff for IP01817.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Er-RA 1..831 1..831 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:10:29 Download gff for IP01817.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Er-RA 18..848 1..831 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:41:29 Download gff for IP01817.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Er-RA 1..636 78..713 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:09:12 Download gff for IP01817.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Er-RA 18..848 1..831 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:24 Download gff for IP01817.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7064416..7064552 1..137 100 -> Plus
2R 7065132..7065299 138..305 100 -> Plus
2R 7065360..7065512 306..458 100 -> Plus
2R 7065684..7065866 459..641 100 -> Plus
2R 7065924..7066113 642..831 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:24 Download gff for IP01817.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7064416..7064552 1..137 100 -> Plus
2R 7065132..7065299 138..305 100 -> Plus
2R 7065360..7065512 306..458 100 -> Plus
2R 7065684..7065866 459..641 100 -> Plus
2R 7065924..7066113 642..831 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:24 Download gff for IP01817.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7064416..7064552 1..137 100 -> Plus
2R 7065132..7065299 138..305 100 -> Plus
2R 7065360..7065512 306..458 100 -> Plus
2R 7065684..7065866 459..641 100 -> Plus
2R 7065924..7066113 642..831 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:10:29 Download gff for IP01817.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2952637..2952804 138..305 100 -> Plus
arm_2R 2952865..2953017 306..458 100 -> Plus
arm_2R 2953189..2953371 459..641 100 -> Plus
arm_2R 2953429..2953618 642..831 100   Plus
arm_2R 2951921..2952057 1..137 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:51:03 Download gff for IP01817.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7065615..7065751 1..137 100 -> Plus
2R 7066331..7066498 138..305 100 -> Plus
2R 7066559..7066711 306..458 100 -> Plus
2R 7066883..7067065 459..641 100 -> Plus
2R 7067123..7067312 642..831 100   Plus

IP01817.hyp Sequence

Translation from 77 to 712

> IP01817.hyp
MGWSPLMIRYLAFLFNFLCAVLGIATIVVNVIAIDQIAPKDQLILGLYIA
VGSIVFLLSFFGCFGAIKESICVTWAYATSMLVMLIVSIVMLFVFRMHFE
EDSITKLKQAFAKQTNTFDAMAEYQTQYQCCGIYKLKDYGDAYITVPSSC
YDQNDTPYRDGCLAKMETQYEELLKGPKIVGWMLMVIEIGAFTFSTIMGV
SLRNELRRSAY*

IP01817.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42Er-PA 211 CG12837-PA 1..211 1..211 1094 100 Plus
Tsp42Ee-PB 228 CG10106-PB 7..228 7..211 266 32.9 Plus
Tsp42Ee-PA 228 CG10106-PA 7..228 7..211 266 32.9 Plus
Tsp42Ea-PC 226 CG18817-PC 7..226 7..211 255 29.1 Plus
Tsp42Ea-PB 226 CG18817-PB 7..226 7..211 255 29.1 Plus

IP01817.pep Sequence

Translation from 77 to 712

> IP01817.pep
MGWSPLMIRYLAFLFNFLCAVLGIATIVVNVIAIDQIAPKDQLILGLYIA
VGSIVFLLSFFGCFGAIKESICVTWAYATSMLVMLIVSIVMLFVFRMHFE
EDSITKLKQAFAKQTNTFDAMAEYQTQYQCCGIYKLKDYGDAYITVPSSC
YDQNDTPYRDGCLAKMETQYEELLKGPKIVGWMLMVIEIGAFTFSTIMGV
SLRNELRRSAY*

IP01817.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13154-PA 226 GF13154-PA 7..226 7..211 266 30.9 Plus
Dana\GF12682-PA 227 GF12682-PA 7..227 7..211 264 33 Plus
Dana\GF19814-PA 201 GF19814-PA 17..168 35..189 248 35.7 Plus
Dana\GF12251-PA 219 GF12251-PA 12..218 12..211 233 28.2 Plus
Dana\GF12686-PA 228 GF12686-PA 1..223 1..209 207 27.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23255-PA 211 GG23255-PA 1..211 1..211 1022 89.6 Plus
Dere\GG10774-PA 219 GG10774-PA 12..218 12..211 247 29.2 Plus
Dere\GG23247-PA 229 GG23247-PA 1..224 1..209 236 28 Plus
Dere\GG23243-PA 228 GG23243-PA 7..228 7..211 225 31.6 Plus
Dere\GG10779-PA 227 GG10779-PA 1..227 1..211 219 29.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21512-PA 218 GH21512-PA 1..218 1..211 465 43.1 Plus
Dgri\GH21494-PA 226 GH21494-PA 7..226 7..211 247 29.7 Plus
Dgri\GH21508-PA 211 GH21508-PA 1..208 1..208 229 28.5 Plus
Dgri\GH21499-PA 230 GH21499-PA 7..230 7..211 226 30 Plus
Dgri\GH21498-PA 227 GH21498-PA 1..227 1..211 225 27.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42Er-PA 211 CG12837-PA 1..211 1..211 1094 100 Plus
Tsp42Ee-PB 228 CG10106-PB 7..228 7..211 266 32.9 Plus
Tsp42Ee-PA 228 CG10106-PA 7..228 7..211 266 32.9 Plus
Tsp42Ea-PC 226 CG18817-PC 7..226 7..211 255 29.1 Plus
Tsp42Ea-PB 226 CG18817-PB 7..226 7..211 255 29.1 Plus
Tsp42Ea-PA 226 CG18817-PA 7..226 7..211 255 29.1 Plus
Tsp42Eq-PA 219 CG12832-PA 8..218 8..211 244 28.2 Plus
lbm-PB 208 CG2374-PB 1..208 1..211 235 29.2 Plus
lbm-PA 208 CG2374-PA 1..208 1..211 235 29.2 Plus
Tsp42Ed-PB 227 CG12846-PB 6..227 6..211 234 29.4 Plus
Tsp42Ed-PA 227 CG12846-PA 6..227 6..211 234 29.4 Plus
Tsp42En-PB 218 CG12839-PB 8..218 8..211 227 25.7 Plus
Tsp42En-PA 218 CG12839-PA 8..218 8..211 227 25.7 Plus
Tsp42Ei-PB 229 CG12843-PB 1..224 1..209 226 26.2 Plus
Tsp42Ei-PA 229 CG12843-PA 1..224 1..209 226 26.2 Plus
Tsp42El-PA 217 CG12840-PA 1..217 1..211 208 27.3 Plus
Tsp42Ek-PB 215 CG12841-PB 1..193 1..189 194 30.7 Plus
Tsp42Ek-PA 215 CG12841-PA 1..193 1..189 194 30.7 Plus
Tsp42Ec-PA 232 CG12847-PA 1..224 1..205 188 23.5 Plus
Tsp47F-PB 239 CG9033-PB 6..236 5..205 179 26 Plus
CG30160-PA 222 CG30160-PA 7..220 7..203 165 25.6 Plus
Tsp42Eb-PB 222 CG18816-PB 7..220 7..203 165 25.6 Plus
Tsp42Ep-PB 250 CG4471-PB 8..199 8..189 161 23.5 Plus
Tsp42Ep-PA 250 CG4471-PA 8..199 8..189 161 23.5 Plus
Tsp42Ef-PA 220 CG12845-PA 7..220 8..211 158 21.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19481-PA 220 GI19481-PA 1..220 1..211 510 45.5 Plus
Dmoj\GI19477-PA 208 GI19477-PA 1..205 1..208 247 29.7 Plus
Dmoj\GI19464-PA 226 GI19464-PA 7..226 7..211 245 29.3 Plus
Dmoj\GI20057-PA 219 GI20057-PA 12..218 12..211 228 27.3 Plus
Dmoj\GI19468-PA 227 GI19468-PA 1..227 1..211 228 29 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11150-PA 210 GL11150-PA 2..204 10..208 393 37.4 Plus
Dper\GL11133-PA 226 GL11133-PA 7..226 7..211 261 31.1 Plus
Dper\GL11136-PA 227 GL11136-PA 1..227 1..211 237 28.7 Plus
Dper\GL11138-PA 252 GL11138-PA 45..252 21..211 230 32.2 Plus
Dper\GL10954-PA 213 GL10954-PA 12..212 12..211 224 28.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24040-PA 223 GA24040-PA 1..197 1..193 383 37.6 Plus
Dpse\GA15095-PA 226 GA15095-PA 7..226 7..211 261 31.1 Plus
Dpse\GA10076-PA 228 GA10076-PA 7..228 7..211 257 32 Plus
Dpse\GA11839-PA 219 GA11839-PA 12..218 12..211 247 28.7 Plus
Dpse\GA11851-PA 227 GA11851-PA 1..227 1..211 237 28.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20928-PA 104 GM20928-PA 21..104 128..211 445 96.4 Plus
Dsec\GM20823-PA 219 GM20823-PA 12..218 12..211 252 29.7 Plus
Dsec\GM20919-PA 229 GM20919-PA 1..224 1..209 237 28 Plus
Dsec\GM20925-PA 208 GM20925-PA 1..205 1..208 235 31 Plus
Dsec\GM18744-PA 228 GM18744-PA 7..228 7..211 227 30.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:18:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10455-PA 211 GD10455-PA 1..211 1..211 1104 98.6 Plus
Dsim\GD10276-PA 219 GD10276-PA 12..218 12..211 245 29.2 Plus
Dsim\GD10444-PA 228 GD10444-PA 7..228 7..211 227 30.2 Plus
Dsim\GD15337-PA 188 GD15337-PA 10..185 32..208 226 31.5 Plus
Dsim\GD10280-PA 227 GD10280-PA 1..227 1..211 226 30 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:18:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15141-PA 220 GJ15141-PA 1..220 1..211 490 47.7 Plus
Dvir\GJ15138-PA 208 GJ15138-PA 1..205 1..208 262 30.2 Plus
Dvir\GJ15124-PA 226 GJ15124-PA 7..226 7..211 250 30.2 Plus
Dvir\GJ14948-PA 219 GJ14948-PA 12..218 12..211 231 29.2 Plus
Dvir\GJ15137-PA 217 GJ15137-PA 1..217 1..211 229 30.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21787-PA 215 GK21787-PA 1..215 1..211 507 46.5 Plus
Dwil\GK21771-PA 226 GK21771-PA 7..226 7..211 257 30.9 Plus
Dwil\GK21531-PA 219 GK21531-PA 12..218 12..211 250 28.2 Plus
Dwil\GK21776-PA 228 GK21776-PA 7..228 7..211 247 30.7 Plus
Dwil\GK21783-PA 217 GK21783-PA 1..217 1..211 230 28.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19105-PA 211 GE19105-PA 1..211 1..211 1095 96.7 Plus
Dyak\GE24235-PA 219 GE24235-PA 12..218 12..211 243 28.7 Plus
Dyak\GE19098-PA 229 GE19098-PA 1..224 1..209 234 28 Plus
Dyak\GE19102-PA 208 GE19102-PA 1..205 1..208 227 30 Plus
Dyak\Tsp42Ed-PA 227 GE24279-PA 1..227 1..211 225 30 Plus