BDGP Sequence Production Resources |
Search the DGRC for IP01853
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 18 |
Well: | 53 |
Vector: | pOT2 |
Associated Gene/Transcript | Lk-RA |
Protein status: | IP01853.pep: gold |
Preliminary Size: | 631 |
Sequenced Size: | 640 |
Gene | Date | Evidence |
---|---|---|
CG13480 | 2005-01-01 | Successful iPCR screen |
Leucokinin | 2008-04-29 | Release 5.5 accounting |
Leucokinin | 2008-08-15 | Release 5.9 accounting |
Leucokinin | 2008-12-18 | 5.12 accounting |
640 bp (640 high quality bases) assembled on 2005-03-01
GenBank Submission: BT023388
> IP01853.complete ATTAAGACGGCTAAAACCGCTGGAGAAGATGGCAAAGATAGTCCTGTGTA TGGTGCTCCTGGCCTTTGGCCGTCAAGTCTATGGAGCCAGCCTGGTGCCG GCACCGATTTCTGAACAGGATCCCGAGTTGGCAACCTGTGAGCTGCAGCT CTCCAAGTACCGCAGGTTCATCCTGCAGGCCATACTGAGCTTTGAGGATG TCTGCGACGCGTACAGCTCCAGGCCCGGTGGCCAGGATTCGGACTCGGAG GGATGGCCCTTCCGGCACTACGCCCCACCACCCACATCTCAGCGTGGCGA GATCTGGGCCTTCTTCCGCCTGCTAATGGCCCAGTTCGGTGACAAGGAGT TCTCGCCCATCATCCGGGATGCGGTGATTGAAAGGTGCCGCATCAAATCC CAGCTGCAGCGCGACGAGAAGCGCAACTCCGTCGTGCTGGGCAAGAAGCA GCGATTCCACTCGTGGGGCGGCAAAAGGTCACCGGAACCACCGATCCTGC CGGACTACTAATTCCGGAGATTCCACTCCCATCGTTTTTCCCATCCAAGT GTATGAACAGCCAAAGTTGAAGTCCTCTAATTAATATCAGTGTCTAAATA AACCCGATGATTGCAAACCGAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 14550248..14550867 | 620..1 | 3100 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 14560138..14560758 | 621..1 | 3105 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 14553238..14553858 | 621..1 | 3105 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 14550248..14550867 | 1..620 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Leucokinin-RA | 1..483 | 29..511 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Leucokinin-RA | 1..483 | 29..511 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Lk-RA | 1..483 | 29..511 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Leucokinin-RA | 1..483 | 29..511 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Lk-RA | 1..483 | 29..511 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Leucokinin-RA | 7..626 | 1..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Leucokinin-RA | 7..626 | 1..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Lk-RA | 7..626 | 1..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Leucokinin-RA | 7..626 | 1..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Lk-RA | 7..626 | 1..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14560139..14560758 | 1..620 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14560139..14560758 | 1..620 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14560139..14560758 | 1..620 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 14553239..14553858 | 1..620 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14553239..14553858 | 1..620 | 100 | Minus |
Translation from 0 to 510
> IP01853.hyp LRRLKPLEKMAKIVLCMVLLAFGRQVYGASLVPAPISEQDPELATCELQL SKYRRFILQAILSFEDVCDAYSSRPGGQDSDSEGWPFRHYAPPPTSQRGE IWAFFRLLMAQFGDKEFSPIIRDAVIERCRIKSQLQRDEKRNSVVLGKKQ RFHSWGGKRSPEPPILPDY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Lk-PA | 160 | CG13480-PA | 1..160 | 10..169 | 848 | 100 | Plus |
Translation from 28 to 510
> IP01853.pep MAKIVLCMVLLAFGRQVYGASLVPAPISEQDPELATCELQLSKYRRFILQ AILSFEDVCDAYSSRPGGQDSDSEGWPFRHYAPPPTSQRGEIWAFFRLLM AQFGDKEFSPIIRDAVIERCRIKSQLQRDEKRNSVVLGKKQRFHSWGGKR SPEPPILPDY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF25194-PA | 157 | GF25194-PA | 6..152 | 6..154 | 631 | 81.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13722-PA | 160 | GG13722-PA | 1..160 | 1..160 | 766 | 88.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16805-PA | 188 | GH16805-PA | 37..156 | 33..152 | 496 | 76.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Lk-PA | 160 | CG13480-PA | 1..160 | 1..160 | 848 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13818-PA | 172 | GI13818-PA | 25..151 | 28..153 | 498 | 75.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL20987-PA | 176 | GL20987-PA | 15..154 | 15..154 | 543 | 75.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12316-PA | 176 | GA12316-PA | 15..154 | 15..154 | 549 | 76.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24543-PA | 160 | GM24543-PA | 1..160 | 1..160 | 795 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12616-PA | 160 | GD12616-PA | 1..160 | 1..160 | 803 | 95 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11685-PA | 176 | GJ11685-PA | 12..152 | 12..156 | 498 | 70.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10593-PA | 175 | GK10593-PA | 1..157 | 1..157 | 568 | 67.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20017-PA | 160 | GE20017-PA | 1..160 | 1..160 | 765 | 88.8 | Plus |