Clone IP01853 Report

Search the DGRC for IP01853

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:18
Well:53
Vector:pOT2
Associated Gene/TranscriptLk-RA
Protein status:IP01853.pep: gold
Preliminary Size:631
Sequenced Size:640

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13480 2005-01-01 Successful iPCR screen
Leucokinin 2008-04-29 Release 5.5 accounting
Leucokinin 2008-08-15 Release 5.9 accounting
Leucokinin 2008-12-18 5.12 accounting

Clone Sequence Records

IP01853.complete Sequence

640 bp (640 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023388

> IP01853.complete
ATTAAGACGGCTAAAACCGCTGGAGAAGATGGCAAAGATAGTCCTGTGTA
TGGTGCTCCTGGCCTTTGGCCGTCAAGTCTATGGAGCCAGCCTGGTGCCG
GCACCGATTTCTGAACAGGATCCCGAGTTGGCAACCTGTGAGCTGCAGCT
CTCCAAGTACCGCAGGTTCATCCTGCAGGCCATACTGAGCTTTGAGGATG
TCTGCGACGCGTACAGCTCCAGGCCCGGTGGCCAGGATTCGGACTCGGAG
GGATGGCCCTTCCGGCACTACGCCCCACCACCCACATCTCAGCGTGGCGA
GATCTGGGCCTTCTTCCGCCTGCTAATGGCCCAGTTCGGTGACAAGGAGT
TCTCGCCCATCATCCGGGATGCGGTGATTGAAAGGTGCCGCATCAAATCC
CAGCTGCAGCGCGACGAGAAGCGCAACTCCGTCGTGCTGGGCAAGAAGCA
GCGATTCCACTCGTGGGGCGGCAAAAGGTCACCGGAACCACCGATCCTGC
CGGACTACTAATTCCGGAGATTCCACTCCCATCGTTTTTCCCATCCAAGT
GTATGAACAGCCAAAGTTGAAGTCCTCTAATTAATATCAGTGTCTAAATA
AACCCGATGATTGCAAACCGAAAAAAAAAAAAAAAAAAAA

IP01853.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:54:29
Subject Length Description Subject Range Query Range Score Percent Strand
Leucokinin-RA 631 Leucokinin-RA 7..627 1..621 3105 100 Plus
nc_12577.a 600 nc_12577.a 18..594 577..1 2885 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:43:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14550248..14550867 620..1 3100 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:32:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:43:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14560138..14560758 621..1 3105 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:43:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14553238..14553858 621..1 3105 100 Minus
Blast to na_te.dros performed on 2019-03-16 23:43:36 has no hits.

IP01853.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:44:28 Download gff for IP01853.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14550248..14550867 1..620 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:15:53 Download gff for IP01853.complete
Subject Subject Range Query Range Percent Splice Strand
Leucokinin-RA 1..483 29..511 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:27:09 Download gff for IP01853.complete
Subject Subject Range Query Range Percent Splice Strand
Leucokinin-RA 1..483 29..511 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:48:28 Download gff for IP01853.complete
Subject Subject Range Query Range Percent Splice Strand
Lk-RA 1..483 29..511 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:11:08 Download gff for IP01853.complete
Subject Subject Range Query Range Percent Splice Strand
Leucokinin-RA 1..483 29..511 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:57:01 Download gff for IP01853.complete
Subject Subject Range Query Range Percent Splice Strand
Lk-RA 1..483 29..511 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:30:13 Download gff for IP01853.complete
Subject Subject Range Query Range Percent Splice Strand
Leucokinin-RA 7..626 1..620 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:27:09 Download gff for IP01853.complete
Subject Subject Range Query Range Percent Splice Strand
Leucokinin-RA 7..626 1..620 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:48:28 Download gff for IP01853.complete
Subject Subject Range Query Range Percent Splice Strand
Lk-RA 7..626 1..620 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:11:08 Download gff for IP01853.complete
Subject Subject Range Query Range Percent Splice Strand
Leucokinin-RA 7..626 1..620 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:57:01 Download gff for IP01853.complete
Subject Subject Range Query Range Percent Splice Strand
Lk-RA 7..626 1..620 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:44:28 Download gff for IP01853.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14560139..14560758 1..620 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:44:28 Download gff for IP01853.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14560139..14560758 1..620 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:44:28 Download gff for IP01853.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14560139..14560758 1..620 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:48:28 Download gff for IP01853.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14553239..14553858 1..620 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:47:43 Download gff for IP01853.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14553239..14553858 1..620 100   Minus

IP01853.hyp Sequence

Translation from 0 to 510

> IP01853.hyp
LRRLKPLEKMAKIVLCMVLLAFGRQVYGASLVPAPISEQDPELATCELQL
SKYRRFILQAILSFEDVCDAYSSRPGGQDSDSEGWPFRHYAPPPTSQRGE
IWAFFRLLMAQFGDKEFSPIIRDAVIERCRIKSQLQRDEKRNSVVLGKKQ
RFHSWGGKRSPEPPILPDY*

IP01853.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
Lk-PA 160 CG13480-PA 1..160 10..169 848 100 Plus

IP01853.pep Sequence

Translation from 28 to 510

> IP01853.pep
MAKIVLCMVLLAFGRQVYGASLVPAPISEQDPELATCELQLSKYRRFILQ
AILSFEDVCDAYSSRPGGQDSDSEGWPFRHYAPPPTSQRGEIWAFFRLLM
AQFGDKEFSPIIRDAVIERCRIKSQLQRDEKRNSVVLGKKQRFHSWGGKR
SPEPPILPDY*

IP01853.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25194-PA 157 GF25194-PA 6..152 6..154 631 81.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:23:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13722-PA 160 GG13722-PA 1..160 1..160 766 88.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:23:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16805-PA 188 GH16805-PA 37..156 33..152 496 76.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:08
Subject Length Description Subject Range Query Range Score Percent Strand
Lk-PA 160 CG13480-PA 1..160 1..160 848 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:23:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13818-PA 172 GI13818-PA 25..151 28..153 498 75.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:23:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20987-PA 176 GL20987-PA 15..154 15..154 543 75.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:23:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12316-PA 176 GA12316-PA 15..154 15..154 549 76.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:23:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24543-PA 160 GM24543-PA 1..160 1..160 795 94.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:23:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12616-PA 160 GD12616-PA 1..160 1..160 803 95 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:23:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11685-PA 176 GJ11685-PA 12..152 12..156 498 70.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:23:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10593-PA 175 GK10593-PA 1..157 1..157 568 67.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:23:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20017-PA 160 GE20017-PA 1..160 1..160 765 88.8 Plus