Clone IP01895 Report

Search the DGRC for IP01895

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:18
Well:95
Vector:pOT2
Associated Gene/TranscriptDef-RA
Protein status:IP01895.pep: gold
Preliminary Size:279
Sequenced Size:420

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1385 2005-01-01 Successful iPCR screen
Def 2008-04-29 Release 5.5 accounting
Def 2008-08-15 Release 5.9 accounting
Def 2008-12-18 5.12 accounting

Clone Sequence Records

IP01895.complete Sequence

420 bp assembled on 2006-11-09

GenBank Submission: BT023384

> IP01895.complete
TATTCCAAGATGAAGTTCTTCGTTCTCGTGGCTATCGCTTTTGCTCTGCT
TGCTTGCGTGGCGCAGGCTCAGCCAGTTTCCGATGTGGATCCAATTCCAG
AGGATCATGTCCTGGTGCATGAGGATGCCCACCAGGAGGTGCTGCAGCAT
AGCCGCCAGAAGCGAGCCACATGCGACCTACTCTCCAAGTGGAACTGGAA
CCACACCGCCTGCGCCGGCCACTGCATTGCCAAGGGGTTCAAAGGCGGCT
ACTGCAACGACAAGGCCGTCTGCGTTTGCCGCAATTGATTTCGTTTCGCT
CTGTGTACACCAAAAATTTTCGTTTTTTAAGTGTCACACATAAAACAAAA
CGTTGAAAAATTCTATATATAAATGGATCCTTTTAATCGACAGATATTTA
AAAAAAAAAAAAAAAAAAAA

IP01895.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:12:38
Subject Length Description Subject Range Query Range Score Percent Strand
Def-RA 279 Def-RA 1..279 10..288 1395 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:03:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5941721..5942117 399..1 1800 97.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:32:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:03:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10054175..10054576 402..1 2010 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10055374..10055775 402..1 2010 100 Minus
Blast to na_te.dros performed on 2019-03-16 08:03:35 has no hits.

IP01895.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:04:13 Download gff for IP01895.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5941721..5942117 1..399 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:15:58 Download gff for IP01895.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 1..279 10..288 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:20:06 Download gff for IP01895.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 1..279 10..288 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:53:16 Download gff for IP01895.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 1..279 10..288 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:36:58 Download gff for IP01895.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 1..279 10..288 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:34:40 Download gff for IP01895.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 1..279 10..288 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:48:23 Download gff for IP01895.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 1..279 10..288 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:20:05 Download gff for IP01895.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 1..399 1..399 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:53:16 Download gff for IP01895.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 1..399 1..399 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:36:58 Download gff for IP01895.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 1..279 10..288 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:34:40 Download gff for IP01895.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 1..399 1..399 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:04:13 Download gff for IP01895.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10054178..10054576 1..399 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:04:13 Download gff for IP01895.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10054178..10054576 1..399 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:04:13 Download gff for IP01895.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10054178..10054576 1..399 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:53:16 Download gff for IP01895.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5941683..5942081 1..399 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:49:13 Download gff for IP01895.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10055377..10055775 1..399 100   Minus

IP01895.hyp Sequence

Translation from 0 to 287

> IP01895.hyp
YSKMKFFVLVAIAFALLACVAQAQPVSDVDPIPEDHVLVHEDAHQEVLQH
SRQKRATCDLLSKWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN*

IP01895.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:38:56
Subject Length Description Subject Range Query Range Score Percent Strand
Def-PA 92 CG1385-PA 1..92 4..95 509 100 Plus

IP01895.pep Sequence

Translation from 9 to 287

> IP01895.pep
MKFFVLVAIAFALLACVAQAQPVSDVDPIPEDHVLVHEDAHQEVLQHSRQ
KRATCDLLSKWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN*

IP01895.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12914-PA 87 GF12914-PA 1..87 1..92 262 57.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25236-PA 92 GG25236-PA 1..92 1..92 448 91.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21581-PA 96 GH21581-PA 1..96 1..92 249 54.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:02
Subject Length Description Subject Range Query Range Score Percent Strand
Def-PA 92 CG1385-PA 1..92 1..92 509 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19416-PA 89 GI19416-PA 1..89 1..92 218 52.2 Plus
Dmoj\GI19553-PA 95 GI19553-PA 4..95 6..92 205 50.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10559-PA 96 GL10559-PA 1..96 1..92 286 60.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12570-PA 96 GA12570-PA 1..96 1..92 286 60.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20557-PA 92 GM20557-PA 1..92 1..92 477 96.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Def-PA 92 GD26010-PA 1..92 1..92 477 96.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22479-PA 88 GJ22479-PA 1..88 1..92 252 58.7 Plus
Dvir\GJ21126-PA 79 GJ21126-PA 1..78 11..91 185 44.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21361-PA 101 GK21361-PA 1..101 1..92 247 48.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21830-PA 92 GE21830-PA 1..92 1..92 450 91.3 Plus