BDGP Sequence Production Resources |
Search the DGRC for IP01895
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 18 |
Well: | 95 |
Vector: | pOT2 |
Associated Gene/Transcript | Def-RA |
Protein status: | IP01895.pep: gold |
Preliminary Size: | 279 |
Sequenced Size: | 420 |
Gene | Date | Evidence |
---|---|---|
CG1385 | 2005-01-01 | Successful iPCR screen |
Def | 2008-04-29 | Release 5.5 accounting |
Def | 2008-08-15 | Release 5.9 accounting |
Def | 2008-12-18 | 5.12 accounting |
420 bp assembled on 2006-11-09
GenBank Submission: BT023384
> IP01895.complete TATTCCAAGATGAAGTTCTTCGTTCTCGTGGCTATCGCTTTTGCTCTGCT TGCTTGCGTGGCGCAGGCTCAGCCAGTTTCCGATGTGGATCCAATTCCAG AGGATCATGTCCTGGTGCATGAGGATGCCCACCAGGAGGTGCTGCAGCAT AGCCGCCAGAAGCGAGCCACATGCGACCTACTCTCCAAGTGGAACTGGAA CCACACCGCCTGCGCCGGCCACTGCATTGCCAAGGGGTTCAAAGGCGGCT ACTGCAACGACAAGGCCGTCTGCGTTTGCCGCAATTGATTTCGTTTCGCT CTGTGTACACCAAAAATTTTCGTTTTTTAAGTGTCACACATAAAACAAAA CGTTGAAAAATTCTATATATAAATGGATCCTTTTAATCGACAGATATTTA AAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Def-RA | 279 | Def-RA | 1..279 | 10..288 | 1395 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 5941721..5942117 | 399..1 | 1800 | 97.8 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 10054175..10054576 | 402..1 | 2010 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 10055374..10055775 | 402..1 | 2010 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 5941721..5942117 | 1..399 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Def-RA | 1..279 | 10..288 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Def-RA | 1..279 | 10..288 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Def-RA | 1..279 | 10..288 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Def-RA | 1..279 | 10..288 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Def-RA | 1..279 | 10..288 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Def-RA | 1..279 | 10..288 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Def-RA | 1..399 | 1..399 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Def-RA | 1..399 | 1..399 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Def-RA | 1..279 | 10..288 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Def-RA | 1..399 | 1..399 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10054178..10054576 | 1..399 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10054178..10054576 | 1..399 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10054178..10054576 | 1..399 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 5941683..5942081 | 1..399 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10055377..10055775 | 1..399 | 100 | Minus |
Translation from 0 to 287
> IP01895.hyp YSKMKFFVLVAIAFALLACVAQAQPVSDVDPIPEDHVLVHEDAHQEVLQH SRQKRATCDLLSKWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Def-PA | 92 | CG1385-PA | 1..92 | 4..95 | 509 | 100 | Plus |
Translation from 9 to 287
> IP01895.pep MKFFVLVAIAFALLACVAQAQPVSDVDPIPEDHVLVHEDAHQEVLQHSRQ KRATCDLLSKWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12914-PA | 87 | GF12914-PA | 1..87 | 1..92 | 262 | 57.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG25236-PA | 92 | GG25236-PA | 1..92 | 1..92 | 448 | 91.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21581-PA | 96 | GH21581-PA | 1..96 | 1..92 | 249 | 54.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Def-PA | 92 | CG1385-PA | 1..92 | 1..92 | 509 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19416-PA | 89 | GI19416-PA | 1..89 | 1..92 | 218 | 52.2 | Plus |
Dmoj\GI19553-PA | 95 | GI19553-PA | 4..95 | 6..92 | 205 | 50.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10559-PA | 96 | GL10559-PA | 1..96 | 1..92 | 286 | 60.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12570-PA | 96 | GA12570-PA | 1..96 | 1..92 | 286 | 60.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20557-PA | 92 | GM20557-PA | 1..92 | 1..92 | 477 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\Def-PA | 92 | GD26010-PA | 1..92 | 1..92 | 477 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22479-PA | 88 | GJ22479-PA | 1..88 | 1..92 | 252 | 58.7 | Plus |
Dvir\GJ21126-PA | 79 | GJ21126-PA | 1..78 | 11..91 | 185 | 44.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21361-PA | 101 | GK21361-PA | 1..101 | 1..92 | 247 | 48.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21830-PA | 92 | GE21830-PA | 1..92 | 1..92 | 450 | 91.3 | Plus |