Clone IP01908 Report

Search the DGRC for IP01908

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:19
Well:8
Vector:pOT2
Associated Gene/TranscriptObp56h-RA
Protein status:IP01908.pep: gold
Preliminary Size:405
Sequenced Size:514

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13874 2005-01-01 Successful iPCR screen
Obp56h 2008-04-29 Release 5.5 accounting
Obp56h 2008-08-15 Release 5.9 accounting
Obp56h 2008-12-18 5.12 accounting

Clone Sequence Records

IP01908.complete Sequence

514 bp (514 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023380

> IP01908.complete
CTTTAACAAATATATACCTCAAAATGAAGTTCACCCTATTCTGTATTGCT
CTGGCAGCTTTTTTGTCCATGGGACAGTGTAATCCGGACTTTCGCCAAAT
AATGCAACAGTGCATGGAGACCAACCAAGTGACCGAGGCTGATCTCAAGG
AGTTCATGGCCAGCGGGATGCAGAGCAGTGCCAAGGAGAACCTCAAGTGC
TACACCAAGTGCCTGATGGAGAAGCAGGGTCATCTCACCAATGGCCAGTT
CAATGCTCAGGCTATGCTCGACACTCTCAAAAATGTGCCTCAGATCAAGG
ACAAAATGGACGAGATTTCCTCGGGAGTGAATGCCTGCAAGGACATCAAG
GGAACCAACGATTGCGACACGGCCTTTAAGGTTACCATGTGCCTGAAGGA
GCACAAGGCCATTCCAGGACATCACTAATGCCTGATCCTGTTCGTCCTAG
TTGGCTTAGTTGCATTTTGTAAAATAAACTTGTTCAAGTTTTACCAAAAA
AAAAAAAAAAAAAA

IP01908.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:40:59
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56h-RA 657 Obp56h-RA 35..532 1..498 2490 100 Plus
Obp56h.a 585 Obp56h.a 70..490 78..498 2105 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:46:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15702904..15703323 76..495 2070 99.5 Plus
chr2R 21145070 chr2R 15702771..15702847 1..77 385 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:32:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19815687..19816109 76..498 2115 100 Plus
2R 25286936 2R 19815554..19815630 1..77 385 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19816886..19817308 76..498 2115 100 Plus
2R 25260384 2R 19816753..19816829 1..77 385 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:46:32 has no hits.

IP01908.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:47:17 Download gff for IP01908.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15702771..15702847 1..77 100 -> Plus
chr2R 15702906..15703323 78..495 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:16:02 Download gff for IP01908.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56h-RA 1..405 24..428 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:07:57 Download gff for IP01908.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56h-RB 1..405 24..428 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:01:29 Download gff for IP01908.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56h-RA 1..405 24..428 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:52:53 Download gff for IP01908.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56h-RA 1..405 24..428 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:20:42 Download gff for IP01908.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56h-RA 1..405 24..428 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:58:29 Download gff for IP01908.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56h-RA 1..405 24..428 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:07:56 Download gff for IP01908.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56h-RA 1..495 1..495 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:01:29 Download gff for IP01908.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56h-RA 1..495 1..495 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:52:53 Download gff for IP01908.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56h-RA 1..405 24..428 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:20:42 Download gff for IP01908.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56h-RA 1..495 1..495 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:47:17 Download gff for IP01908.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19815689..19816106 78..495 100   Plus
2R 19815554..19815630 1..77 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:47:17 Download gff for IP01908.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19815689..19816106 78..495 100   Plus
2R 19815554..19815630 1..77 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:47:17 Download gff for IP01908.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19815689..19816106 78..495 100   Plus
2R 19815554..19815630 1..77 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:01:29 Download gff for IP01908.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15703059..15703135 1..77 100 -> Plus
arm_2R 15703194..15703611 78..495 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:27:50 Download gff for IP01908.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19816888..19817305 78..495 100   Plus
2R 19816753..19816829 1..77 100 -> Plus

IP01908.hyp Sequence

Translation from 2 to 427

> IP01908.hyp
LTNIYLKMKFTLFCIALAAFLSMGQCNPDFRQIMQQCMETNQVTEADLKE
FMASGMQSSAKENLKCYTKCLMEKQGHLTNGQFNAQAMLDTLKNVPQIKD
KMDEISSGVNACKDIKGTNDCDTAFKVTMCLKEHKAIPGHH*

IP01908.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:39:15
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56h-PB 134 CG13874-PB 1..134 8..141 715 100 Plus
Obp56h-PA 134 CG13874-PA 1..134 8..141 715 100 Plus
Obp56g-PA 131 CG13873-PA 1..128 8..132 153 28.2 Plus
Obp56g-PB 132 CG13873-PB 30..129 31..132 152 28.2 Plus
Obp56a-PA 139 CG11797-PA 16..135 15..138 141 28 Plus

IP01908.pep Sequence

Translation from 23 to 427

> IP01908.pep
MKFTLFCIALAAFLSMGQCNPDFRQIMQQCMETNQVTEADLKEFMASGMQ
SSAKENLKCYTKCLMEKQGHLTNGQFNAQAMLDTLKNVPQIKDKMDEISS
GVNACKDIKGTNDCDTAFKVTMCLKEHKAIPGHH*

IP01908.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:41:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11738-PA 133 GF11738-PA 21..133 22..134 519 82.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22002-PA 134 GG22002-PA 1..134 1..134 665 91.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23020-PA 135 GH23020-PA 2..130 1..129 447 62.8 Plus
Dgri\GH23016-PA 135 GH23016-PA 4..130 5..128 141 31.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:34
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56h-PB 134 CG13874-PB 1..134 1..134 715 100 Plus
Obp56h-PA 134 CG13874-PA 1..134 1..134 715 100 Plus
Obp56g-PA 131 CG13873-PA 1..128 1..125 153 28.2 Plus
Obp56g-PB 132 CG13873-PB 30..129 24..125 152 28.2 Plus
Obp56a-PA 139 CG11797-PA 16..135 8..131 141 28 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21087-PA 135 GI21087-PA 9..133 4..132 498 71.3 Plus
Dmoj\GI21083-PA 130 GI21083-PA 10..128 5..129 141 29.7 Plus
Dmoj\GI18535-PA 135 GI18535-PA 1..128 1..127 133 29.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:41:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10361-PA 134 GL10361-PA 1..134 1..134 626 85.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:41:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp56h-PA 134 GA12590-PA 1..134 1..134 626 85.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:41:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21983-PA 134 GM21983-PA 1..134 1..134 695 97 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:41:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp56h-PA 134 GD11481-PA 1..134 1..134 698 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp56h-PA 135 GJ20934-PA 1..133 1..132 474 65.4 Plus
Dvir\Obp56eL1-PA 130 GJ20932-PA 1..130 1..131 146 26.7 Plus
Dvir\Obp56g-PA 135 GJ21405-PA 27..128 24..127 141 29.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15892-PA 137 GK15892-PA 6..135 5..134 565 76.2 Plus
Dwil\GK15894-PA 138 GK15894-PA 17..128 13..127 134 27.6 Plus
Dwil\GK15687-PA 138 GK15687-PA 17..128 13..127 134 27.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:41:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12081-PA 134 GE12081-PA 1..134 1..134 680 93.3 Plus
Dyak\Obp56e-PA 132 GE12075-PA 10..130 3..129 134 28.3 Plus