Clone IP01956 Report

Search the DGRC for IP01956

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:19
Well:56
Vector:pOT2
Associated Gene/TranscriptTsp42A-RA
Protein status:IP01956.pep: gold
Preliminary Size:714
Sequenced Size:958

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14468 2005-01-01 Successful iPCR screen
Tsp42A 2008-04-29 Release 5.5 accounting
Tsp42A 2008-08-15 Release 5.9 accounting
Tsp42A 2008-12-18 5.12 accounting

Clone Sequence Records

IP01956.complete Sequence

958 bp (958 high quality bases) assembled on 2006-05-24

GenBank Submission: BT025811

> IP01956.complete
AGGAATTCGTGTTGCGCAACTGACGCGGCGCTTTCATCAACTGGAGCCTA
ACCCGGCGAAATGGCTAATCCGTTTCGCTGGTGTCGAGTGTCGCACGACT
GCGTGTTCCAGATTAATGTGGTTCTGGTGGTGGTCGGAGTGATCTTTCTG
CTTGACGTGCTCAGCCACCTTTATCTGAAGGCGGTCATGTTTCCAGGCCT
TCGTCTATACCCGGTAGCCTTGCGCCCCTGGCTCTTTTGGGTGCGCGCTT
TGACAATGGTTGCCTACATTTTGAACGCTGTTCTTGGGATTCACATGGCC
CGACAACCCACCGTCTTGAAGTACGCTGGCTATATGCTCGTTGGAAGCGT
GGTGTTGCTGTACACAATAAGCATCGGAGTGACTCGCTTCATGTACCGCA
AAAGATTCGAGTTCTTTGCCGAGATGCTGGTGCTGCAGATGTGGGTGAGA
GATAGACTTGGCAAGGTTGAAGTAGAGTTCGAGTGCTGCGGAAGGTCCAG
CGTAGTTGACTACCAGACAGCATCGAGCAACCGCACCTGGCCCATTGGCT
CTTGCTGCGGGAAGCAGAACTGCACCGGCTGCACTGCGAAGCTTAGCCAG
TACCTGTGGACTATCGAGATGGATGTGGCAAGGGATAATATTATCGTATC
CGTTCTCTTGTTTGTGGCGATGATCGTCATGGTTTTACACTTTAAAGATG
TGCAATCGCTCGACGACACTAGTGATGTGGATGAGTCTTCAGAACTGGTA
GACGACTCGGACGCCAAAGAATAAGCCCCATCCCATCTAGTCGTGCCGGT
CCCAATTGCTTTTATATGGTCCCCCTCATTCAAGTACATAAATACTATTT
TGAATGTGATATTACCCATGCCTTTAGGGCATATACAGTGTATATTTATT
TTTTTGCGACAAAGGTAAATACACTGATTAGATCTGAAAAAAAAAAAAAA
AAAAAAAA

IP01956.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:17:31
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42A-RA 936 Tsp42A-RA 1..936 1..936 4680 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:57:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 1682801..1683736 1..936 4665 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:32:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:57:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5795413..5796350 1..938 4690 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:10:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 5796612..5797549 1..938 4690 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:57:20 has no hits.

IP01956.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:58:21 Download gff for IP01956.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 1682801..1683736 1..936 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:16:14 Download gff for IP01956.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42A-RA 1..714 61..774 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:30:32 Download gff for IP01956.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42A-RA 1..714 61..774 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:42:22 Download gff for IP01956.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42A-RA 1..714 61..774 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:01:42 Download gff for IP01956.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42A-RA 1..714 61..774 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:23:32 Download gff for IP01956.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42A-RA 1..714 61..774 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:01:49 Download gff for IP01956.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42A-RA 1..714 61..774 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:30:32 Download gff for IP01956.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42A-RA 1..936 1..936 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:42:22 Download gff for IP01956.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42A-RA 1..936 1..936 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:01:42 Download gff for IP01956.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42A-RA 1..714 61..774 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:23:32 Download gff for IP01956.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42A-RA 1..936 1..936 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:58:21 Download gff for IP01956.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5795413..5796348 1..936 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:58:21 Download gff for IP01956.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5795413..5796348 1..936 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:58:21 Download gff for IP01956.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5795413..5796348 1..936 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:42:22 Download gff for IP01956.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1682918..1683853 1..936 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:56:06 Download gff for IP01956.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5796612..5797547 1..936 100   Plus

IP01956.hyp Sequence

Translation from 60 to 773

> IP01956.hyp
MANPFRWCRVSHDCVFQINVVLVVVGVIFLLDVLSHLYLKAVMFPGLRLY
PVALRPWLFWVRALTMVAYILNAVLGIHMARQPTVLKYAGYMLVGSVVLL
YTISIGVTRFMYRKRFEFFAEMLVLQMWVRDRLGKVEVEFECCGRSSVVD
YQTASSNRTWPIGSCCGKQNCTGCTAKLSQYLWTIEMDVARDNIIVSVLL
FVAMIVMVLHFKDVQSLDDTSDVDESSELVDDSDAKE*

IP01956.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42A-PB 237 CG14468-PB 1..237 1..237 1236 100 Plus
Tsp42A-PA 237 CG14468-PA 1..237 1..237 1236 100 Plus

IP01956.pep Sequence

Translation from 60 to 773

> IP01956.pep
MANPFRWCRVSHDCVFQINVVLVVVGVIFLLDVLSHLYLKAVMFPGLRLY
PVALRPWLFWVRALTMVAYILNAVLGIHMARQPTVLKYAGYMLVGSVVLL
YTISIGVTRFMYRKRFEFFAEMLVLQMWVRDRLGKVEVEFECCGRSSVVD
YQTASSNRTWPIGSCCGKQNCTGCTAKLSQYLWTIEMDVARDNIIVSVLL
FVAMIVMVLHFKDVQSLDDTSDVDESSELVDDSDAKE*

IP01956.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23186-PA 259 GF23186-PA 1..215 1..215 794 64.2 Plus
Dana\GF13834-PA 259 GF13834-PA 1..215 1..215 780 63.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23182-PA 238 GG23182-PA 1..238 1..237 1090 85.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:54:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20419-PA 230 GH20419-PA 7..218 8..219 424 35 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:59
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42A-PB 237 CG14468-PB 1..237 1..237 1236 100 Plus
Tsp42A-PA 237 CG14468-PA 1..237 1..237 1236 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19602-PA 263 GI19602-PA 10..231 10..233 329 30.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20055-PA 259 GL20055-PA 6..224 6..222 527 48.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13005-PA 259 GA13005-PA 6..224 6..222 509 47.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16522-PA 237 GM16522-PA 1..237 1..237 1150 93.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:54:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10386-PA 237 GD10386-PA 1..237 1..237 1162 94.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:54:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18411-PA 249 GJ18411-PA 1..218 1..219 414 35 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21761-PA 246 GK21761-PA 5..220 6..219 520 43.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15282-PA 238 GE15282-PA 1..238 1..237 1133 89.5 Plus