BDGP Sequence Production Resources |
Search the DGRC for IP01962
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 19 |
Well: | 62 |
Vector: | pOT2 |
Associated Gene/Transcript | ORMDL-RA |
Protein status: | IP01962.pep: gold |
Preliminary Size: | 465 |
Sequenced Size: | 671 |
Gene | Date | Evidence |
---|---|---|
CG14577 | 2005-01-01 | Successful iPCR screen |
ORMDL | 2008-04-29 | Release 5.5 accounting |
ORMDL | 2008-08-15 | Release 5.9 accounting |
ORMDL | 2008-12-18 | 5.12 accounting |
671 bp (671 high quality bases) assembled on 2005-03-01
GenBank Submission: BT023364
> IP01962.complete AAATGATAAATATTTGTTATTAAAGTGTTTCGGAACCAAAGGTTAACAAT TCAGCCACATGACGTCCATTGCGGGAGGCCACGGCGAGGCGAATCCAAAC AGCTCCTGGCTGAGTGCCCGGGGATTTTGGCTAGCATACCTCCTGGGCCT GCTGTCGGTGCACCTGCTCTTCTTATCAGTGCCCTTCGTTAGCATTCCAT GGGCCTGGACGGCTACCAACCTGCTTCACAATGCAGCCCACCTGTACTTT CTGCACGTCATCAAGGGCGCTCCCTGGCTCAGCACGGAGAACGATCCCAG CCGGCGTTGGACGCACTGGGAACAGATCGATGACGGGGTACAGATGACCA CAACGCGCAAGTTCCTCACAGCTGTTCCCATTGTTCTTTTCCTACTTACC TGTCTGTACACCCGAAACAACACGGAACACTTTATCCCAAACTTTATATC CCTGGTGGTCGTCACGCTTCCCAAGCTGCCGCAGTTCCACGGCGTGCGGC TGTTCAACATTAACAAGTACTAGCTCCTGTGAGAACGGGCCGCATTTATT TTGTTTAATGAAAATGTACATACAAACTTATATTGATGGCACAGCTCTTG CTCAAAAATGTAAATATTGCTAAATAAAATATTTATCAAATTAAATAATT CTAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 21624923..21625187 | 388..652 | 1325 | 100 | Plus |
chr3L | 24539361 | chr3L | 21624263..21624498 | 1..236 | 1180 | 100 | Plus |
chr3L | 24539361 | chr3L | 21624554..21624705 | 236..387 | 745 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 21635987..21636256 | 388..657 | 1350 | 100 | Plus |
3L | 28110227 | 3L | 21635327..21635562 | 1..236 | 1180 | 100 | Plus |
3L | 28110227 | 3L | 21635618..21635769 | 236..387 | 745 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 21629087..21629356 | 388..657 | 1350 | 100 | Plus |
3L | 28103327 | 3L | 21628427..21628662 | 1..236 | 1180 | 100 | Plus |
3L | 28103327 | 3L | 21628718..21628869 | 236..387 | 745 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dbif\P-element_M | 2935 | Dbif\P-element_M P_M 2935bp Derived from X60990. | 2532..2635 | 652..546 | 121 | 60.7 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 21624263..21624497 | 1..235 | 100 | -> | Plus |
chr3L | 21624554..21624705 | 236..387 | 99 | -> | Plus |
chr3L | 21624923..21625153 | 388..618 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ORMDL-RA | 1..465 | 59..523 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ORMDL-RA | 1..465 | 59..523 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ORMDL-RA | 1..465 | 59..523 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ORMDL-RA | 1..465 | 59..523 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ORMDL-RA | 1..465 | 59..523 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ORMDL-RA | 1..465 | 59..523 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ORMDL-RA | 23..674 | 1..652 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ORMDL-RA | 23..674 | 1..652 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ORMDL-RA | 1..465 | 59..523 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ORMDL-RA | 23..674 | 1..652 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21635987..21636251 | 388..652 | 100 | Plus | |
3L | 21635327..21635561 | 1..235 | 100 | -> | Plus |
3L | 21635618..21635769 | 236..387 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21635987..21636251 | 388..652 | 100 | Plus | |
3L | 21635327..21635561 | 1..235 | 100 | -> | Plus |
3L | 21635618..21635769 | 236..387 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21635987..21636251 | 388..652 | 100 | Plus | |
3L | 21635327..21635561 | 1..235 | 100 | -> | Plus |
3L | 21635618..21635769 | 236..387 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 21628718..21628869 | 236..387 | 99 | -> | Plus |
arm_3L | 21628427..21628661 | 1..235 | 100 | -> | Plus |
arm_3L | 21629087..21629351 | 388..652 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21628427..21628661 | 1..235 | 100 | -> | Plus |
3L | 21628718..21628869 | 236..387 | 99 | -> | Plus |
3L | 21629087..21629351 | 388..652 | 100 | Plus |
Translation from 58 to 522
> IP01962.hyp MTSIAGGHGEANPNSSWLSARGFWLAYLLGLLSVHLLFLSVPFVSIPWAW TATNLLHNAAHLYFLHVIKGAPWLSTENDPSRRWTHWEQIDDGVQMTTTR KFLTAVPIVLFLLTCLYTRNNTEHFIPNFISLVVVTLPKLPQFHGVRLFN INKY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ORMDL-PA | 154 | CG14577-PA | 1..154 | 1..154 | 835 | 100 | Plus |
Translation from 58 to 522
> IP01962.pep MTSIAGGHGEANPNSSWLSARGFWLAYLLGLLSVHLLFLSVPFVSIPWAW TATNLLHNAAHLYFLHVIKGAPWLSTENDPSRRWTHWEQIDDGVQMTTTR KFLTAVPIVLFLLTCLYTRNNTEHFIPNFISLVVVTLPKLPQFHGVRLFN INKY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23733-PA | 154 | GF23733-PA | 1..154 | 1..154 | 693 | 94.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16210-PA | 154 | GG16210-PA | 1..154 | 1..154 | 795 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16360-PA | 154 | GH16360-PA | 1..154 | 1..154 | 679 | 90.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ORMDL-PA | 154 | CG14577-PA | 1..154 | 1..154 | 835 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11551-PA | 154 | GI11551-PA | 1..154 | 1..154 | 673 | 89 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24847-PA | 154 | GL24847-PA | 1..154 | 1..154 | 701 | 91.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13094-PA | 154 | GA13094-PA | 1..154 | 1..154 | 701 | 91.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22391-PA | 154 | GM22391-PA | 1..154 | 1..154 | 798 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14981-PA | 154 | GD14981-PA | 1..154 | 1..154 | 798 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11230-PA | 154 | GJ11230-PA | 1..154 | 1..154 | 674 | 89.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17050-PA | 154 | GK17050-PA | 1..154 | 1..154 | 752 | 91.6 | Plus |