Clone IP01962 Report

Search the DGRC for IP01962

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:19
Well:62
Vector:pOT2
Associated Gene/TranscriptORMDL-RA
Protein status:IP01962.pep: gold
Preliminary Size:465
Sequenced Size:671

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14577 2005-01-01 Successful iPCR screen
ORMDL 2008-04-29 Release 5.5 accounting
ORMDL 2008-08-15 Release 5.9 accounting
ORMDL 2008-12-18 5.12 accounting

Clone Sequence Records

IP01962.complete Sequence

671 bp (671 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023364

> IP01962.complete
AAATGATAAATATTTGTTATTAAAGTGTTTCGGAACCAAAGGTTAACAAT
TCAGCCACATGACGTCCATTGCGGGAGGCCACGGCGAGGCGAATCCAAAC
AGCTCCTGGCTGAGTGCCCGGGGATTTTGGCTAGCATACCTCCTGGGCCT
GCTGTCGGTGCACCTGCTCTTCTTATCAGTGCCCTTCGTTAGCATTCCAT
GGGCCTGGACGGCTACCAACCTGCTTCACAATGCAGCCCACCTGTACTTT
CTGCACGTCATCAAGGGCGCTCCCTGGCTCAGCACGGAGAACGATCCCAG
CCGGCGTTGGACGCACTGGGAACAGATCGATGACGGGGTACAGATGACCA
CAACGCGCAAGTTCCTCACAGCTGTTCCCATTGTTCTTTTCCTACTTACC
TGTCTGTACACCCGAAACAACACGGAACACTTTATCCCAAACTTTATATC
CCTGGTGGTCGTCACGCTTCCCAAGCTGCCGCAGTTCCACGGCGTGCGGC
TGTTCAACATTAACAAGTACTAGCTCCTGTGAGAACGGGCCGCATTTATT
TTGTTTAATGAAAATGTACATACAAACTTATATTGATGGCACAGCTCTTG
CTCAAAAATGTAAATATTGCTAAATAAAATATTTATCAAATTAAATAATT
CTAAAAAAAAAAAAAAAAAAA

IP01962.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:54:30
Subject Length Description Subject Range Query Range Score Percent Strand
ORMDL.a 953 ORMDL.a 75..731 1..657 3270 99.8 Plus
ORMDL-RA 731 ORMDL-RA 75..731 1..657 3270 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:44:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21624923..21625187 388..652 1325 100 Plus
chr3L 24539361 chr3L 21624263..21624498 1..236 1180 100 Plus
chr3L 24539361 chr3L 21624554..21624705 236..387 745 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:32:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:44:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21635987..21636256 388..657 1350 100 Plus
3L 28110227 3L 21635327..21635562 1..236 1180 100 Plus
3L 28110227 3L 21635618..21635769 236..387 745 99.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21629087..21629356 388..657 1350 100 Plus
3L 28103327 3L 21628427..21628662 1..236 1180 100 Plus
3L 28103327 3L 21628718..21628869 236..387 745 99.3 Plus
Blast to na_te.dros performed 2019-03-15 19:44:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_M 2935 Dbif\P-element_M P_M 2935bp Derived from X60990. 2532..2635 652..546 121 60.7 Minus

IP01962.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:45:38 Download gff for IP01962.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21624263..21624497 1..235 100 -> Plus
chr3L 21624554..21624705 236..387 99 -> Plus
chr3L 21624923..21625153 388..618 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:16:16 Download gff for IP01962.complete
Subject Subject Range Query Range Percent Splice Strand
ORMDL-RA 1..465 59..523 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:27:10 Download gff for IP01962.complete
Subject Subject Range Query Range Percent Splice Strand
ORMDL-RA 1..465 59..523 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:56:59 Download gff for IP01962.complete
Subject Subject Range Query Range Percent Splice Strand
ORMDL-RA 1..465 59..523 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:11:09 Download gff for IP01962.complete
Subject Subject Range Query Range Percent Splice Strand
ORMDL-RA 1..465 59..523 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:23:15 Download gff for IP01962.complete
Subject Subject Range Query Range Percent Splice Strand
ORMDL-RA 1..465 59..523 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:30:15 Download gff for IP01962.complete
Subject Subject Range Query Range Percent Splice Strand
ORMDL-RA 1..465 59..523 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:27:10 Download gff for IP01962.complete
Subject Subject Range Query Range Percent Splice Strand
ORMDL-RA 23..674 1..652 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:56:59 Download gff for IP01962.complete
Subject Subject Range Query Range Percent Splice Strand
ORMDL-RA 23..674 1..652 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:11:09 Download gff for IP01962.complete
Subject Subject Range Query Range Percent Splice Strand
ORMDL-RA 1..465 59..523 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:23:15 Download gff for IP01962.complete
Subject Subject Range Query Range Percent Splice Strand
ORMDL-RA 23..674 1..652 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:45:38 Download gff for IP01962.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21635987..21636251 388..652 100   Plus
3L 21635327..21635561 1..235 100 -> Plus
3L 21635618..21635769 236..387 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:45:38 Download gff for IP01962.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21635987..21636251 388..652 100   Plus
3L 21635327..21635561 1..235 100 -> Plus
3L 21635618..21635769 236..387 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:45:38 Download gff for IP01962.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21635987..21636251 388..652 100   Plus
3L 21635327..21635561 1..235 100 -> Plus
3L 21635618..21635769 236..387 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:56:59 Download gff for IP01962.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21628718..21628869 236..387 99 -> Plus
arm_3L 21628427..21628661 1..235 100 -> Plus
arm_3L 21629087..21629351 388..652 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:47:44 Download gff for IP01962.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21628427..21628661 1..235 100 -> Plus
3L 21628718..21628869 236..387 99 -> Plus
3L 21629087..21629351 388..652 100   Plus

IP01962.hyp Sequence

Translation from 58 to 522

> IP01962.hyp
MTSIAGGHGEANPNSSWLSARGFWLAYLLGLLSVHLLFLSVPFVSIPWAW
TATNLLHNAAHLYFLHVIKGAPWLSTENDPSRRWTHWEQIDDGVQMTTTR
KFLTAVPIVLFLLTCLYTRNNTEHFIPNFISLVVVTLPKLPQFHGVRLFN
INKY*

IP01962.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
ORMDL-PA 154 CG14577-PA 1..154 1..154 835 100 Plus

IP01962.pep Sequence

Translation from 58 to 522

> IP01962.pep
MTSIAGGHGEANPNSSWLSARGFWLAYLLGLLSVHLLFLSVPFVSIPWAW
TATNLLHNAAHLYFLHVIKGAPWLSTENDPSRRWTHWEQIDDGVQMTTTR
KFLTAVPIVLFLLTCLYTRNNTEHFIPNFISLVVVTLPKLPQFHGVRLFN
INKY*

IP01962.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:23:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23733-PA 154 GF23733-PA 1..154 1..154 693 94.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:23:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16210-PA 154 GG16210-PA 1..154 1..154 795 98.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:24:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16360-PA 154 GH16360-PA 1..154 1..154 679 90.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
ORMDL-PA 154 CG14577-PA 1..154 1..154 835 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:24:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11551-PA 154 GI11551-PA 1..154 1..154 673 89 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:24:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24847-PA 154 GL24847-PA 1..154 1..154 701 91.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:24:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13094-PA 154 GA13094-PA 1..154 1..154 701 91.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:24:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22391-PA 154 GM22391-PA 1..154 1..154 798 99.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:24:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14981-PA 154 GD14981-PA 1..154 1..154 798 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11230-PA 154 GJ11230-PA 1..154 1..154 674 89.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17050-PA 154 GK17050-PA 1..154 1..154 752 91.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19779-PA 154 GE19779-PA 1..154 1..154 796 98.7 Plus
Dyak\GE23040-PA 154 GE23040-PA 1..154 1..154 796 98.7 Plus