Clone IP01982 Report

Search the DGRC for IP01982

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:19
Well:82
Vector:pOT2
Associated Gene/Transcriptrobl37BC-RA
Protein status:IP01982.pep: gold
Preliminary Size:348
Sequenced Size:628

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15171 2005-01-01 Successful iPCR screen
robl37BC 2008-04-29 Release 5.5 accounting
robl37BC 2008-08-15 Release 5.9 accounting
robl37BC 2008-12-18 5.12 accounting

Clone Sequence Records

IP01982.complete Sequence

628 bp (628 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023356

> IP01982.complete
CTATAGTTCACCCAAATAGGGATCCACTTCCGCTCTTGGAAGCCATGGCG
TCAAACACTGTGCAGATGACCTTCGATCGGCTGGTTCAGCTGCCAGGCGT
GACGGGGGCAATCCTGATCGATGGCAATGGAGTTCCGGTGCGGACCAATT
TGCCAGCGAATGTGGCCCGCATATACGCCGATCGGATGAGGCCACTGGTG
ATTCTGGCCCGATCCATGGTGCAGGATTTGGAGAATGGGGACGAGCTGAG
TTACGTGCGGCTGCGCACCCGCCGCCAGGAGACGATGGTGGCCACCGAGA
ACGAGCACACGATCATTCTGATCCAGGACAACCGTGTGCTCGACGAATCC
TGGAGGAGCAGTGTCGCCTCGCGGAGAGCCTCGGCGCTCTAACGGCTTCG
AGTTCAGTAGGGATCGTAAACCAGCTGCGCCAGCGGGTAACGACCACGTC
CTGATGTCCTGGCTGAGAGAAGTCCTTGCACGGACGAGCTCACAAATCCA
AAGTACAGAGCTGAAATTGTGAGCCGGGACATTGCTGTGCTGGAAGAGCA
CGCAAAAATAAAATCCACATACAGGCGGGGTAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP01982.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
robl37BC-RA 617 robl37BC-RA 37..617 1..581 2905 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19009659..19010239 1..581 2845 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:33:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19010952..19011535 1..584 2920 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19010952..19011535 1..584 2920 100 Plus
Blast to na_te.dros performed 2019-03-16 23:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\ninja 6644 Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). 852..891 386..425 110 75 Plus
aurora-element 4263 aurora-element DMAURA 4263bp Derived from AB022762 (d1268008) (Rel. 59, Last updated, Version 1). 653..692 386..425 110 75 Plus

IP01982.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:49:39 Download gff for IP01982.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19009659..19010239 1..581 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:16:21 Download gff for IP01982.complete
Subject Subject Range Query Range Percent Splice Strand
robl37BC-RA 1..348 45..392 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:27:12 Download gff for IP01982.complete
Subject Subject Range Query Range Percent Splice Strand
robl37BC-RA 1..348 45..392 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:50:34 Download gff for IP01982.complete
Subject Subject Range Query Range Percent Splice Strand
robl37BC-RA 1..348 45..392 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:11:10 Download gff for IP01982.complete
Subject Subject Range Query Range Percent Splice Strand
robl37BC-RA 1..348 45..392 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:00:16 Download gff for IP01982.complete
Subject Subject Range Query Range Percent Splice Strand
robl37BC-RA 1..348 45..392 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:30:16 Download gff for IP01982.complete
Subject Subject Range Query Range Percent Splice Strand
robl37BC-RA 1..348 45..392 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:27:11 Download gff for IP01982.complete
Subject Subject Range Query Range Percent Splice Strand
robl37BC-RA 37..617 1..581 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:50:34 Download gff for IP01982.complete
Subject Subject Range Query Range Percent Splice Strand
robl37BC-RA 87..667 1..581 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:11:11 Download gff for IP01982.complete
Subject Subject Range Query Range Percent Splice Strand
robl37BC-RA 1..348 45..392 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:00:16 Download gff for IP01982.complete
Subject Subject Range Query Range Percent Splice Strand
robl37BC-RA 87..667 1..581 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:49:39 Download gff for IP01982.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19010952..19011532 1..581 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:49:39 Download gff for IP01982.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19010952..19011532 1..581 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:49:39 Download gff for IP01982.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19010952..19011532 1..581 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:50:34 Download gff for IP01982.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19010952..19011532 1..581 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:47:46 Download gff for IP01982.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19010952..19011532 1..581 100   Plus

IP01982.hyp Sequence

Translation from 2 to 391

> IP01982.hyp
IVHPNRDPLPLLEAMASNTVQMTFDRLVQLPGVTGAILIDGNGVPVRTNL
PANVARIYADRMRPLVILARSMVQDLENGDELSYVRLRTRRQETMVATEN
EHTIILIQDNRVLDESWRSSVASRRASAL*

IP01982.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:41:43
Subject Length Description Subject Range Query Range Score Percent Strand
robl37BC-PA 115 CG15171-PA 1..115 15..129 567 100 Plus
robl-PA 97 CG10751-PA 2..94 17..109 155 33.3 Plus
robl22E-PB 97 CG10838-PB 2..93 17..108 143 31.5 Plus
robl22E-PA 97 CG10838-PA 2..93 17..108 143 31.5 Plus

IP01982.pep Sequence

Translation from 44 to 391

> IP01982.pep
MASNTVQMTFDRLVQLPGVTGAILIDGNGVPVRTNLPANVARIYADRMRP
LVILARSMVQDLENGDELSYVRLRTRRQETMVATENEHTIILIQDNRVLD
ESWRSSVASRRASAL*

IP01982.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:24:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19684-PA 122 GF19684-PA 1..113 1..113 314 53.1 Plus
Dana\GF13122-PA 97 GF13122-PA 2..94 3..95 154 33.3 Plus
Dana\GF15283-PA 97 GF15283-PA 2..93 3..94 140 30.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:24:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21147-PA 115 GG21147-PA 1..114 1..114 500 85.1 Plus
Dere\GG20680-PA 100 GG20680-PA 5..97 3..95 154 33.3 Plus
Dere\GG24530-PA 97 GG24530-PA 2..93 3..94 137 30.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:24:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21399-PA 97 GH21399-PA 2..94 3..95 154 33.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
robl37BC-PA 115 CG15171-PA 1..115 1..115 567 100 Plus
robl-PA 97 CG10751-PA 2..94 3..95 155 33.3 Plus
robl22E-PB 97 CG10838-PB 2..93 3..94 143 31.5 Plus
robl22E-PA 97 CG10838-PA 2..93 3..94 143 31.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:24:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18578-PA 108 GI18578-PA 13..105 3..95 154 33.3 Plus
Dmoj\GI16945-PA 110 GI16945-PA 1..101 3..106 132 31.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:24:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27334-PA 112 GL27334-PA 4..103 6..105 293 52 Plus
Dper\GL11426-PA 97 GL11426-PA 2..94 3..95 154 33.3 Plus
Dper\GL19405-PA 97 GL19405-PA 2..93 3..94 140 33.7 Plus
Dper\GL26110-PA 97 GL26110-PA 2..93 3..94 131 29.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:24:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13548-PA 112 GA13548-PA 4..103 6..105 289 52 Plus
Dpse\GA10543-PA 97 GA10543-PA 2..94 3..95 154 33.3 Plus
Dpse\GA10586-PA 97 GA10586-PA 2..93 3..94 140 33.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:24:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17309-PA 51 GM17309-PA 1..48 1..48 243 97.9 Plus
Dsec\GM17310-PA 58 GM17310-PA 1..44 58..101 219 97.7 Plus
Dsec\GM21776-PA 97 GM21776-PA 2..94 3..95 154 33.3 Plus
Dsec\GM26651-PA 97 GM26651-PA 2..94 3..95 154 33.3 Plus
Dsec\GM18239-PA 97 GM18239-PA 2..93 3..94 147 31.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:24:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11269-PA 97 GD11269-PA 2..94 3..95 154 33.3 Plus
Dsim\GD22844-PA 97 GD22844-PA 2..93 3..94 147 31.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:24:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20372-PA 97 GJ20372-PA 2..94 3..95 154 33.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:24:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19376-PA 116 GK19376-PA 2..110 3..111 315 51.4 Plus
Dwil\GK22899-PA 97 GK22899-PA 2..94 3..95 154 33.3 Plus
Dwil\GK19463-PA 124 GK19463-PA 23..109 11..94 135 32.2 Plus
Dwil\GK14988-PA 97 GK14988-PA 2..93 3..94 134 31.5 Plus
Dwil\GK18698-PA 97 GK18698-PA 11..94 12..95 130 32.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13221-PA 115 GE13221-PA 1..115 1..115 521 88.7 Plus
Dyak\GE11664-PA 97 GE11664-PA 2..94 3..95 154 33.3 Plus
Dyak\GE15136-PA 97 GE15136-PA 2..93 3..94 141 30.4 Plus