Clone IP01991 Report

Search the DGRC for IP01991

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:19
Well:91
Vector:pOT2
Associated Gene/TranscriptDip1-RA
Protein status:IP01991.pep: gold
Preliminary Size:659
Sequenced Size:709

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15367 2005-01-01 Successful iPCR screen
Dip1 2008-04-29 Release 5.5 accounting
Dip1 2008-08-15 Release 5.9 accounting
Dip1 2008-12-18 5.12 accounting

Clone Sequence Records

IP01991.complete Sequence

709 bp (709 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023357

> IP01991.complete
AAACATTTTAATTCAAATTTTAGATTGTGAATAACATTCCTTAGCAACAA
CCATAATGGACATATTCGAGAGCTTCTGTCGCACGTGCGGAAACGAATGC
CTGGAATCGCTGTCCATTTACAATGAGTGTGCCCAAGTGCTTGACCAGAT
GGTGCCCATTGCGGATATGCTAGCGTCCTGCCTGCCCGCCTCCTTGCCGC
CACTGGACCCAGAGGACGACTATCCCAAACAGATCTGCCGCATCTGCGTG
AAGAAGCTGTCGATGGCCTACGAGTTCAGCCACCAGTGGCTGGGCGCCCA
CGGCGAGTTCAACGTGGCCCTAAAGTTCGAGCAGCGCCGAAGGCGCAGCC
AGGCCAGCAAATCCCAGTCGCACACGCAAACCCAAACTCATCCGGTGGAA
CCGAAGAATGAGCAACTGCCCACGGTGCTGGCGGAAGCAGTGTCGACCAA
AAGAGCTGCTACTCCCACCAACGAGTTCAGCAGCGACTCCGGACCGGCCT
TCAAGTGCGGCTTCTGCGGCGAATGTTTTTACACGGAGAAGGCCTGCAAA
TTTCACTTAAAGTTCTCGCACAAGGATCTTTAGAGAACTGTCTGTTTTTT
CCCTTACTTGTAATTTGGTTTTAAGTGTATAAATCTTTTGTGAAATTAAT
TTTAAATTAGGAATATATATATATATTCCTTCTCTTTATACAAAAAAAAA
AAAAAAAAA

IP01991.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:54:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dip1-RA 744 Dip1-RA 57..744 1..688 3440 100 Plus
Dip1.a 696 Dip1.a 3..696 1..691 3400 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:12:13
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 9050422..9050875 1..455 2210 99.6 Plus
chrX 22417052 chrX 9050937..9051176 454..691 1105 98.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:33:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:12:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9158622..9159076 1..455 2275 100 Plus
X 23542271 X 9159138..9159377 454..693 1200 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:43:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 9166720..9167174 1..455 2275 100 Plus
X 23527363 X 9167236..9167475 454..693 1200 100 Plus
Blast to na_te.dros performed 2019-03-16 13:12:12
Subject Length Description Subject Range Query Range Score Percent Strand
1360 3409 1360 1360 3409bp 672..761 683..595 132 65.2 Minus
Idefix 7411 Idefix DME9736 7411bp Derived from AJ009736 (e1371475) (Rel. 58, Last updated, Version 1). 782..927 687..552 122 58.5 Minus
Idefix 7411 Idefix DME9736 7411bp Derived from AJ009736 (e1371475) (Rel. 58, Last updated, Version 1). 786..888 653..552 116 59.6 Minus
Dvir\Tv1 6868 Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). 1214..1261 625..675 112 74.5 Plus

IP01991.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:13:10 Download gff for IP01991.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 9050422..9050875 1..455 99 -> Plus
chrX 9050939..9051122 456..639 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:16:24 Download gff for IP01991.complete
Subject Subject Range Query Range Percent Splice Strand
Dip1-RA 1..528 56..583 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:26:53 Download gff for IP01991.complete
Subject Subject Range Query Range Percent Splice Strand
Dip1-RA 1..528 56..583 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:16:42 Download gff for IP01991.complete
Subject Subject Range Query Range Percent Splice Strand
Dip1-RA 1..528 56..583 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:10:55 Download gff for IP01991.complete
Subject Subject Range Query Range Percent Splice Strand
Dip1-RA 1..528 56..583 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:15:20 Download gff for IP01991.complete
Subject Subject Range Query Range Percent Splice Strand
Dip1-RA 1..528 56..583 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:29:53 Download gff for IP01991.complete
Subject Subject Range Query Range Percent Splice Strand
Dip1-RA 1..659 30..688 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:26:53 Download gff for IP01991.complete
Subject Subject Range Query Range Percent Splice Strand
Dip1-RA 1..659 30..688 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:16:42 Download gff for IP01991.complete
Subject Subject Range Query Range Percent Splice Strand
Dip1-RA 1..691 1..691 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:10:55 Download gff for IP01991.complete
Subject Subject Range Query Range Percent Splice Strand
Dip1-RA 1..659 30..688 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:15:20 Download gff for IP01991.complete
Subject Subject Range Query Range Percent Splice Strand
Dip1-RA 1..691 1..691 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:13:10 Download gff for IP01991.complete
Subject Subject Range Query Range Percent Splice Strand
X 9158622..9159076 1..455 100 -> Plus
X 9159140..9159375 456..691 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:13:10 Download gff for IP01991.complete
Subject Subject Range Query Range Percent Splice Strand
X 9158622..9159076 1..455 100 -> Plus
X 9159140..9159375 456..691 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:13:10 Download gff for IP01991.complete
Subject Subject Range Query Range Percent Splice Strand
X 9158622..9159076 1..455 100 -> Plus
X 9159140..9159375 456..691 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:16:42 Download gff for IP01991.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9053173..9053408 456..691 100   Plus
arm_X 9052655..9053109 1..455 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:47:28 Download gff for IP01991.complete
Subject Subject Range Query Range Percent Splice Strand
X 9166720..9167174 1..455 100 -> Plus
X 9167238..9167473 456..691 100   Plus

IP01991.hyp Sequence

Translation from 55 to 582

> IP01991.hyp
MDIFESFCRTCGNECLESLSIYNECAQVLDQMVPIADMLASCLPASLPPL
DPEDDYPKQICRICVKKLSMAYEFSHQWLGAHGEFNVALKFEQRRRRSQA
SKSQSHTQTQTHPVEPKNEQLPTVLAEAVSTKRAATPTNEFSSDSGPAFK
CGFCGECFYTEKACKFHLKFSHKDL*

IP01991.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dip1-PA 175 CG15367-PA 1..175 1..175 947 100 Plus
Dip1-PB 176 CG15367-PB 1..176 1..175 935 99.4 Plus

IP01991.pep Sequence

Translation from 55 to 582

> IP01991.pep
MDIFESFCRTCGNECLESLSIYNECAQVLDQMVPIADMLASCLPASLPPL
DPEDDYPKQICRICVKKLSMAYEFSHQWLGAHGEFNVALKFEQRRRRSQA
SKSQSHTQTQTHPVEPKNEQLPTVLAEAVSTKRAATPTNEFSSDSGPAFK
CGFCGECFYTEKACKFHLKFSHKDL*

IP01991.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:21:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19084-PA 186 GF19084-PA 1..183 1..173 474 57.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18292-PA 184 GG18292-PA 1..184 1..175 669 76.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:21:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17762-PA 185 GH17762-PA 1..177 1..174 393 44.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dlip1-PA 175 CG15367-PA 1..175 1..175 947 100 Plus
Dlip1-PB 176 CG15367-PB 1..176 1..175 935 99.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:21:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15096-PA 216 GI15096-PA 1..206 1..174 388 39.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:21:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13675-PA 191 GA13675-PA 1..189 1..172 449 48.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13724-PA 176 GM13724-PA 1..176 1..175 812 88.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:21:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16933-PA 178 GD16933-PA 1..178 1..175 832 90.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:21:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18903-PA 217 GJ18903-PA 1..207 1..174 375 37.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:21:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25705-PA 215 GK25705-PA 17..212 1..174 395 43.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:21:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15826-PA 184 GE15826-PA 1..184 1..175 692 75.5 Plus