Clone IP02009 Report

Search the DGRC for IP02009

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:20
Well:9
Vector:pOT2
Associated Gene/TranscriptObp19c-RA
Protein status:IP02009.pep: gold
Preliminary Size:594
Sequenced Size:995

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15457 2005-01-01 Successful iPCR screen
Obp19c 2008-04-29 Release 5.5 accounting
Obp19c 2008-08-15 Release 5.9 accounting
Obp19c 2008-12-18 5.12 accounting

Clone Sequence Records

IP02009.complete Sequence

995 bp (995 high quality bases) assembled on 2006-03-22

GenBank Submission: BT025013

> IP02009.complete
CGATGTCAAATATCGTCTTTGGAGCGTGACTTGTGCGGGTGACGAACTTG
GGTGATGAACTTGGCACTGGAGAAATGCTTGCAATCAGCAAAATCAAGCG
ACGATGCCATGTGCAGACGACTATGGTGTGAGGTCATGGGTCAGCTTATA
AGCCAAGGGGCCAAGCAAGAGCAGAGCCAAAGAGAAAGCAGCTGCCAAGA
TGAAGCCATCCACTCCAGTCGCAGCCATTCCGCTAATGACGATAGTGGTC
GCTGTCCTGCTGCAGACGCACTGCGTCCGTGGCCAGACCCAGGCTTTCGA
TCTCGCCAAGCTGCTGCCCAAGACCGGAACGGAGCCCATCTGGGCGGTAA
TCGATCGCAACTTGCCGCAGGTGCAGGAGCTGGTCACCGCGGCCAGGATG
GAGTGCATCCAGAAGCTGCAGCTGCCCAGGGACCAGCGACCGCTGGGGAA
GGTGACCAATCCAAGTGAGAAGGAGAAGTGCCTGGTGGAGTGCGTGCTCA
AGAAGATCAAGTTGATGGACGCCGACAACAAGCTGAACGTTGGCCAGGTG
GAGAAGCTGACCAGCCTGGTGACCCAGGACAACAAGATGGCCATCGCCGT
TAGCTCCAGCATGGCGCAGGCCTGCAGCCGCGGCATCTCCTCGAAGAACC
CCTGCGAGGTGGCCCACCTCTTCAACCAGTGCATCAGTCGCCAGCTGGAG
CGCAACAACGTAAAGCTGGTCTGGTAGAGGACATCTCCGCGCCATGGACA
CCACCACCAACTACCACTTGAGATCTTAACTACGAGTAGAAAGAAGGTGT
CTCGCATATTTTGGCCATAATCTTAGCTACAATGATTTCTCAGATAATTT
TAACCGAAAATGCACAATCTATTAGGCAATATAATTATATATTAAATACT
AGTTATACGATTTTCTAGTACTAGATCAAGTTTTAGTTGCTCACTCGCAA
TTGATTTGAATAAATCTATATATACAGTAAAAAAAAAAAAAAAAA

IP02009.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
Obp19c-RA 1098 Obp19c-RA 36..1015 1..980 4900 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:30:27
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20283962..20284475 514..1 2495 99 Minus
chrX 22417052 chrX 20283418..20283896 978..514 2120 96.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:33:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:30:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20418451..20418964 514..1 2570 100 Minus
X 23542271 X 20417919..20418385 980..514 2335 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:04:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20403543..20404056 514..1 2570 100 Minus
X 23527363 X 20403011..20403477 980..514 2335 100 Minus
Blast to na_te.dros performed on 2019-03-15 12:30:26 has no hits.

IP02009.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:31:18 Download gff for IP02009.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20283418..20283486 911..978 97 -> Minus
chrX 20283500..20283895 515..910 99 <- Minus
chrX 20283962..20284475 1..514 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:16:28 Download gff for IP02009.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19c-RA 1..528 200..727 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:37:49 Download gff for IP02009.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19c-RA 1..528 200..727 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:44:03 Download gff for IP02009.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19c-RA 1..528 200..727 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:14:13 Download gff for IP02009.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19c-RA 1..528 200..727 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:01:17 Download gff for IP02009.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19c-RA 1..528 200..727 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:41:57 Download gff for IP02009.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19c-RA 1..978 1..978 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:37:49 Download gff for IP02009.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19c-RA 1..978 1..978 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:44:03 Download gff for IP02009.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19c-RA 1..978 1..978 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:14:13 Download gff for IP02009.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19c-RA 1..978 1..978 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:01:17 Download gff for IP02009.complete
Subject Subject Range Query Range Percent Splice Strand
Obp19c-RA 1..978 1..978 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:31:18 Download gff for IP02009.complete
Subject Subject Range Query Range Percent Splice Strand
X 20417921..20418384 515..978 100 <- Minus
X 20418451..20418964 1..514 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:31:18 Download gff for IP02009.complete
Subject Subject Range Query Range Percent Splice Strand
X 20417921..20418384 515..978 100 <- Minus
X 20418451..20418964 1..514 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:31:18 Download gff for IP02009.complete
Subject Subject Range Query Range Percent Splice Strand
X 20417921..20418384 515..978 100 <- Minus
X 20418451..20418964 1..514 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:44:03 Download gff for IP02009.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20288948..20289411 515..978 100 <- Minus
arm_X 20289478..20289991 1..514 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:50:29 Download gff for IP02009.complete
Subject Subject Range Query Range Percent Splice Strand
X 20403013..20403476 515..978 100 <- Minus
X 20403543..20404056 1..514 100   Minus

IP02009.hyp Sequence

Translation from 199 to 726

> IP02009.hyp
MKPSTPVAAIPLMTIVVAVLLQTHCVRGQTQAFDLAKLLPKTGTEPIWAV
IDRNLPQVQELVTAARMECIQKLQLPRDQRPLGKVTNPSEKEKCLVECVL
KKIKLMDADNKLNVGQVEKLTSLVTQDNKMAIAVSSSMAQACSRGISSKN
PCEVAHLFNQCISRQLERNNVKLVW*

IP02009.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:42:29
Subject Length Description Subject Range Query Range Score Percent Strand
Obp19c-PC 175 CG15457-PC 1..175 1..175 892 100 Plus
Obp19c-PA 175 CG15457-PA 1..175 1..175 892 100 Plus

IP02009.pep Sequence

Translation from 199 to 726

> IP02009.pep
MKPSTPVAAIPLMTIVVAVLLQTHCVRGQTQAFDLAKLLPKTGTEPIWAV
IDRNLPQVQELVTAARMECIQKLQLPRDQRPLGKVTNPSEKEKCLVECVL
KKIKLMDADNKLNVGQVEKLTSLVTQDNKMAIAVSSSMAQACSRGISSKN
PCEVAHLFNQCISRQLERNNVKLVW*

IP02009.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19490-PA 169 GF19490-PA 18..169 24..175 570 67.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17992-PA 175 GG17992-PA 1..175 1..175 840 91.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:42:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17591-PA 171 GH17591-PA 17..171 23..175 434 52.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:21
Subject Length Description Subject Range Query Range Score Percent Strand
Obp19c-PC 175 CG15457-PC 1..175 1..175 892 100 Plus
Obp19c-PA 175 CG15457-PA 1..175 1..175 892 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:42:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16240-PA 177 GI16240-PA 34..177 33..175 423 54.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:42:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26792-PA 171 GL26792-PA 20..171 22..175 569 68.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:42:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp19c-PA 171 GA13744-PA 20..171 22..175 571 68.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:42:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22673-PA 163 GM22673-PA 1..163 1..175 800 90.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:42:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp19c-PA 175 GD15537-PA 1..175 1..175 879 96.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:42:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp19c-PA 174 GJ15932-PA 20..174 24..175 406 49 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19718-PA 185 GK19718-PA 54..185 44..175 449 60.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15349-PA 177 GE15349-PA 1..177 1..175 811 88.1 Plus