BDGP Sequence Production Resources |
Search the DGRC for IP02031
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 20 |
Well: | 31 |
Vector: | pOT2 |
Associated Gene/Transcript | Tim9a-RA |
Protein status: | IP02031.pep: gold |
Preliminary Size: | 465 |
Sequenced Size: | 465 |
Gene | Date | Evidence |
---|---|---|
CG1660 | 2005-01-01 | Successful iPCR screen |
Tim9a | 2008-04-29 | Release 5.5 accounting |
Tim9a | 2008-08-15 | Release 5.9 accounting |
Tim9a | 2008-12-18 | 5.12 accounting |
465 bp (465 high quality bases) assembled on 2006-05-24
GenBank Submission: BT025812
> IP02031.complete CCCTTTTTCGTTTCGGCAATTTTGAATAAAATATCGCAGAACAAAATGGC TAAGACACCGGAAAACATAGCCATCGATCAGTTGGACAAGGATCAAATTA AGACGTTTTCCGACTTCCTAATGTCCTACAACAAACTGTCCGAGACGTGC TTCACAGATTGCATACGCGACTTTACAACGCGGGATGTTAAGGATTCCGA GGAGAAGTGCTCGCTGAACTGCATGGAAAAGTATCTGAAGATGAACCAAC GCGTCTCGCAGCGTTTCCAGGAGTTCCAGGTTATTGCCCACGAGAACGCA CTGGCCATGGCTCAAAAGACTGGCAAACTTTAGGTGTTATAGCTGTTACA AACAATCTTAACTAGTTTAGACAACTGAGATGATGCATTTTCCTGCATTT GTCAAAATAGCTGAGTAAAGAAACGCGTTGACGGAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tim9a-RA | 597 | Tim9a-RA | 144..579 | 1..436 | 2180 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 13276434..13276668 | 200..434 | 1160 | 99.6 | Plus |
chrX | 22417052 | chrX | 13276067..13276171 | 1..105 | 525 | 100 | Plus |
chrX | 22417052 | chrX | 13276274..13276371 | 105..202 | 475 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 13276067..13276171 | 1..105 | 100 | -> | Plus |
chrX | 13276275..13276370 | 106..201 | 98 | -> | Plus |
chrX | 13276436..13276668 | 202..434 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tim9a-RA | 1..288 | 46..333 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tim9a-RA | 1..288 | 46..333 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tim9a-RA | 1..288 | 46..333 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tim9a-RA | 1..288 | 46..333 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tim9a-RA | 1..288 | 46..333 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tim9a-RA | 43..465 | 1..423 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tim9a-RA | 83..516 | 1..434 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tim9a-RA | 83..516 | 1..434 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tim9a-RA | 43..465 | 1..423 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tim9a-RA | 83..516 | 1..434 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 13385500..13385595 | 106..201 | 100 | -> | Plus |
X | 13385661..13385893 | 202..434 | 100 | Plus | |
X | 13385292..13385396 | 1..105 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 13385500..13385595 | 106..201 | 100 | -> | Plus |
X | 13385661..13385893 | 202..434 | 100 | Plus | |
X | 13385292..13385396 | 1..105 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 13385500..13385595 | 106..201 | 100 | -> | Plus |
X | 13385661..13385893 | 202..434 | 100 | Plus | |
X | 13385292..13385396 | 1..105 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 13279325..13279429 | 1..105 | 100 | -> | Plus |
arm_X | 13279533..13279628 | 106..201 | 100 | -> | Plus |
arm_X | 13279694..13279926 | 202..434 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 13393390..13393494 | 1..105 | 100 | -> | Plus |
X | 13393598..13393693 | 106..201 | 100 | -> | Plus |
X | 13393759..13393991 | 202..434 | 100 | Plus |
Translation from 0 to 332
> IP02031.hyp PFFVSAILNKISQNKMAKTPENIAIDQLDKDQIKTFSDFLMSYNKLSETC FTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRVSQRFQEFQVIAHENA LAMAQKTGKL*
Translation from 45 to 332
> IP02031.pep MAKTPENIAIDQLDKDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKD SEEKCSLNCMEKYLKMNQRVSQRFQEFQVIAHENALAMAQKTGKL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19407-PA | 95 | GF19407-PA | 1..95 | 1..95 | 464 | 90.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17778-PA | 95 | GG17778-PA | 1..94 | 1..94 | 458 | 90.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24494-PA | 95 | GH24494-PA | 1..95 | 1..95 | 442 | 84.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tim9a-PB | 95 | CG1660-PB | 1..95 | 1..95 | 493 | 100 | Plus |
Tim9a-PA | 95 | CG1660-PA | 1..95 | 1..95 | 493 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15249-PA | 95 | GI15249-PA | 1..95 | 1..95 | 452 | 87.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26920-PA | 94 | GL26920-PA | 1..94 | 1..94 | 398 | 77.7 | Plus |
Dper\GL18474-PA | 94 | GL18474-PA | 1..94 | 1..94 | 385 | 75.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25649-PA | 94 | GA25649-PA | 1..94 | 1..94 | 385 | 75.5 | Plus |
Dpse\GA22671-PA | 94 | GA22671-PA | 1..94 | 1..94 | 382 | 75.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11629-PA | 95 | GM11629-PA | 1..95 | 1..95 | 494 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17121-PA | 95 | GD17121-PA | 1..95 | 1..95 | 490 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14821-PA | 95 | GJ14821-PA | 1..95 | 1..95 | 452 | 87.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25286-PA | 95 | GK25286-PA | 1..95 | 1..95 | 424 | 78.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17072-PA | 95 | GE17072-PA | 1..95 | 1..95 | 478 | 94.7 | Plus |