Clone IP02031 Report

Search the DGRC for IP02031

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:20
Well:31
Vector:pOT2
Associated Gene/TranscriptTim9a-RA
Protein status:IP02031.pep: gold
Preliminary Size:465
Sequenced Size:465

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1660 2005-01-01 Successful iPCR screen
Tim9a 2008-04-29 Release 5.5 accounting
Tim9a 2008-08-15 Release 5.9 accounting
Tim9a 2008-12-18 5.12 accounting

Clone Sequence Records

IP02031.complete Sequence

465 bp (465 high quality bases) assembled on 2006-05-24

GenBank Submission: BT025812

> IP02031.complete
CCCTTTTTCGTTTCGGCAATTTTGAATAAAATATCGCAGAACAAAATGGC
TAAGACACCGGAAAACATAGCCATCGATCAGTTGGACAAGGATCAAATTA
AGACGTTTTCCGACTTCCTAATGTCCTACAACAAACTGTCCGAGACGTGC
TTCACAGATTGCATACGCGACTTTACAACGCGGGATGTTAAGGATTCCGA
GGAGAAGTGCTCGCTGAACTGCATGGAAAAGTATCTGAAGATGAACCAAC
GCGTCTCGCAGCGTTTCCAGGAGTTCCAGGTTATTGCCCACGAGAACGCA
CTGGCCATGGCTCAAAAGACTGGCAAACTTTAGGTGTTATAGCTGTTACA
AACAATCTTAACTAGTTTAGACAACTGAGATGATGCATTTTCCTGCATTT
GTCAAAATAGCTGAGTAAAGAAACGCGTTGACGGAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAA

IP02031.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:17:32
Subject Length Description Subject Range Query Range Score Percent Strand
Tim9a-RA 597 Tim9a-RA 144..579 1..436 2180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:30:40
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 13276434..13276668 200..434 1160 99.6 Plus
chrX 22417052 chrX 13276067..13276171 1..105 525 100 Plus
chrX 22417052 chrX 13276274..13276371 105..202 475 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:33:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:30:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13385659..13385895 200..436 1185 100 Plus
X 23542271 X 13385292..13385396 1..105 525 100 Plus
X 23542271 X 13385499..13385596 105..202 490 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:10:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13393757..13393993 200..436 1185 100 Plus
X 23527363 X 13393390..13393494 1..105 525 100 Plus
X 23527363 X 13393597..13393694 105..202 490 100 Plus
Blast to na_te.dros performed on 2019-03-15 12:30:39 has no hits.

IP02031.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:31:24 Download gff for IP02031.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 13276067..13276171 1..105 100 -> Plus
chrX 13276275..13276370 106..201 98 -> Plus
chrX 13276436..13276668 202..434 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:16:29 Download gff for IP02031.complete
Subject Subject Range Query Range Percent Splice Strand
Tim9a-RA 1..288 46..333 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:30:34 Download gff for IP02031.complete
Subject Subject Range Query Range Percent Splice Strand
Tim9a-RA 1..288 46..333 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:44:11 Download gff for IP02031.complete
Subject Subject Range Query Range Percent Splice Strand
Tim9a-RA 1..288 46..333 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:01:46 Download gff for IP02031.complete
Subject Subject Range Query Range Percent Splice Strand
Tim9a-RA 1..288 46..333 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:01:33 Download gff for IP02031.complete
Subject Subject Range Query Range Percent Splice Strand
Tim9a-RA 1..288 46..333 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:01:51 Download gff for IP02031.complete
Subject Subject Range Query Range Percent Splice Strand
Tim9a-RA 43..465 1..423 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:30:34 Download gff for IP02031.complete
Subject Subject Range Query Range Percent Splice Strand
Tim9a-RA 83..516 1..434 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:44:11 Download gff for IP02031.complete
Subject Subject Range Query Range Percent Splice Strand
Tim9a-RA 83..516 1..434 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:01:47 Download gff for IP02031.complete
Subject Subject Range Query Range Percent Splice Strand
Tim9a-RA 43..465 1..423 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:01:33 Download gff for IP02031.complete
Subject Subject Range Query Range Percent Splice Strand
Tim9a-RA 83..516 1..434 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:31:24 Download gff for IP02031.complete
Subject Subject Range Query Range Percent Splice Strand
X 13385500..13385595 106..201 100 -> Plus
X 13385661..13385893 202..434 100   Plus
X 13385292..13385396 1..105 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:31:24 Download gff for IP02031.complete
Subject Subject Range Query Range Percent Splice Strand
X 13385500..13385595 106..201 100 -> Plus
X 13385661..13385893 202..434 100   Plus
X 13385292..13385396 1..105 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:31:24 Download gff for IP02031.complete
Subject Subject Range Query Range Percent Splice Strand
X 13385500..13385595 106..201 100 -> Plus
X 13385661..13385893 202..434 100   Plus
X 13385292..13385396 1..105 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:44:11 Download gff for IP02031.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13279325..13279429 1..105 100 -> Plus
arm_X 13279533..13279628 106..201 100 -> Plus
arm_X 13279694..13279926 202..434 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:56:07 Download gff for IP02031.complete
Subject Subject Range Query Range Percent Splice Strand
X 13393390..13393494 1..105 100 -> Plus
X 13393598..13393693 106..201 100 -> Plus
X 13393759..13393991 202..434 100   Plus

IP02031.hyp Sequence

Translation from 0 to 332

> IP02031.hyp
PFFVSAILNKISQNKMAKTPENIAIDQLDKDQIKTFSDFLMSYNKLSETC
FTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRVSQRFQEFQVIAHENA
LAMAQKTGKL*

IP02031.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:42:34
Subject Length Description Subject Range Query Range Score Percent Strand
Tim9a-PB 95 CG1660-PB 1..95 16..110 493 100 Plus
Tim9a-PA 95 CG1660-PA 1..95 16..110 493 100 Plus

IP02031.pep Sequence

Translation from 45 to 332

> IP02031.pep
MAKTPENIAIDQLDKDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKD
SEEKCSLNCMEKYLKMNQRVSQRFQEFQVIAHENALAMAQKTGKL*

IP02031.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19407-PA 95 GF19407-PA 1..95 1..95 464 90.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17778-PA 95 GG17778-PA 1..94 1..94 458 90.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24494-PA 95 GH24494-PA 1..95 1..95 442 84.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
Tim9a-PB 95 CG1660-PB 1..95 1..95 493 100 Plus
Tim9a-PA 95 CG1660-PA 1..95 1..95 493 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15249-PA 95 GI15249-PA 1..95 1..95 452 87.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26920-PA 94 GL26920-PA 1..94 1..94 398 77.7 Plus
Dper\GL18474-PA 94 GL18474-PA 1..94 1..94 385 75.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25649-PA 94 GA25649-PA 1..94 1..94 385 75.5 Plus
Dpse\GA22671-PA 94 GA22671-PA 1..94 1..94 382 75.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11629-PA 95 GM11629-PA 1..95 1..95 494 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17121-PA 95 GD17121-PA 1..95 1..95 490 96.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14821-PA 95 GJ14821-PA 1..95 1..95 452 87.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:54:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25286-PA 95 GK25286-PA 1..95 1..95 424 78.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:54:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17072-PA 95 GE17072-PA 1..95 1..95 478 94.7 Plus