Clone IP02048 Report

Search the DGRC for IP02048

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:20
Well:48
Vector:pOT2
Associated Gene/TranscriptVm32E-RA
Protein status:IP02048.pep: gold
Preliminary Size:437
Sequenced Size:428

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16874 2005-01-01 Successful iPCR screen
Vm32E 2008-04-29 Release 5.5 accounting
Vm32E 2008-08-15 Release 5.9 accounting
Vm32E 2008-12-18 5.12 accounting

Clone Sequence Records

IP02048.complete Sequence

428 bp (428 high quality bases) assembled on 2006-01-20

GenBank Submission: BT024440.1

> IP02048.complete
CATCATGCAGATCGTTGCTCTCACCCTCGTTGCGTTTGTGGCCATTGCCG
GTGCCTCCTGCCCGTATGCAGCTCCAGCTCCAGCTTATTCAGCGCCCGCT
GCTTCTTCTGGCTACCCGGCTCCACCATGCCCCACCAACTACCTGTTCAG
CTGCCAGCCCAATTTGGCCCCAGCTCCTTGTGCCCAGGAGGCCCCAGCCT
ATGGATCCGCCGGCGCCTACACAGAACAGGTGCCCCACTACGTGGGAAGT
CCCAACCGAGAGCAGTTGCAGCAATTTCACCAGCGCATTGGAATGGCGGC
TTTGATGGAGGAACTGCGCGGCTTGGGCCAAGGAATCCAGGGTCAACAGT
ACTAGTGGCAAAAAAAAATTCATGTGAAGAATGTTTTCGAATTAAATCCG
TCTATGCTTTAAAAAAAAAAAAAAAAAA

IP02048.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
Vm32E-RA 437 Vm32E-RA 28..437 1..410 2050 100 Plus
Vm34Ca-RA 491 Vm34Ca-RA 256..314 115..173 205 89.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:22:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11169953..11170362 410..1 2050 100 Minus
chr2L 23010047 chr2L 13409980..13410038 173..115 205 89.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:33:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:22:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11171227..11171638 412..1 2060 100 Minus
2L 23513712 2L 13411318..13411376 173..115 205 89.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:04:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11171227..11171638 412..1 2060 100 Minus
2L 23513712 2L 13411318..13411376 173..115 205 89.8 Minus
Blast to na_te.dros performed 2019-03-16 13:22:15
Subject Length Description Subject Range Query Range Score Percent Strand
TART-C 11124 TART-C TARTC 11124bp 8764..8854 89..1 117 60.4 Minus
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 7311..7369 89..31 106 64.4 Minus

IP02048.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:23:16 Download gff for IP02048.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11169953..11170362 1..410 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:16:32 Download gff for IP02048.complete
Subject Subject Range Query Range Percent Splice Strand
Vm32E-RA 1..351 5..355 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:16:02 Download gff for IP02048.complete
Subject Subject Range Query Range Percent Splice Strand
Vm32E-RA 1..351 5..355 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:15 Download gff for IP02048.complete
Subject Subject Range Query Range Percent Splice Strand
Vm32E-RA 1..351 5..355 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:38:13 Download gff for IP02048.complete
Subject Subject Range Query Range Percent Splice Strand
Vm32E-RA 1..351 5..355 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:18:04 Download gff for IP02048.complete
Subject Subject Range Query Range Percent Splice Strand
Vm32E-RA 1..351 5..355 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:49:31 Download gff for IP02048.complete
Subject Subject Range Query Range Percent Splice Strand
Vm32E-RA 28..437 1..410 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:16:02 Download gff for IP02048.complete
Subject Subject Range Query Range Percent Splice Strand
Vm32E-RA 28..437 1..410 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:15 Download gff for IP02048.complete
Subject Subject Range Query Range Percent Splice Strand
Vm32E-RA 28..437 1..410 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:38:13 Download gff for IP02048.complete
Subject Subject Range Query Range Percent Splice Strand
Vm32E-RA 28..437 1..410 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:18:04 Download gff for IP02048.complete
Subject Subject Range Query Range Percent Splice Strand
Vm32E-RA 28..437 1..410 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:23:16 Download gff for IP02048.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11171229..11171638 1..410 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:23:16 Download gff for IP02048.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11171229..11171638 1..410 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:23:16 Download gff for IP02048.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11171229..11171638 1..410 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:15 Download gff for IP02048.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11171229..11171638 1..410 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:46:27 Download gff for IP02048.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11171229..11171638 1..410 100   Minus

IP02048.hyp Sequence

Translation from 0 to 408

> IP02048.hyp
HHADRCSHPRCVCGHCRCLLPVCSSSSSLFSARCFFWLPGSTMPHQLPVQ
LPAQFGPSSLCPGGPSLWIRRRLHRTGAPLRGKSQPRAVAAISPAHWNGG
FDGGTARLGPRNPGSTVLVAKKNSCEECFRIKSVYA
Sequence IP02048.hyp has no blast hits.

IP02048.pep Sequence

Translation from 1 to 354

> IP02048.pep
IMQIVALTLVAFVAIAGASCPYAAPAPAYSAPAASSGYPAPPCPTNYLFS
CQPNLAPAPCAQEAPAYGSAGAYTEQVPHYVGSPNREQLQQFHQRIGMAA
LMEELRGLGQGIQGQQY*

IP02048.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:06:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15128-PA 105 GF15128-PA 1..105 2..117 342 59.5 Plus
Dana\GF21650-PA 118 GF21650-PA 70..111 39..80 165 73.8 Plus
Dana\GF14293-PA 147 GF14293-PA 79..131 40..88 164 64.2 Plus
Dana\GF15591-PA 163 GF15591-PA 114..162 39..87 161 63.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:06:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10317-PA 113 GG10317-PA 1..102 2..106 331 78.1 Plus
Dere\GG10199-PA 119 GG10199-PA 71..116 39..84 166 69.6 Plus
Dere\GG24269-PA 142 GG24269-PA 73..126 39..88 165 64.8 Plus
Dere\GG25107-PA 174 GG25107-PA 125..173 39..87 153 61.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11097-PA 106 GH11097-PA 58..103 39..84 169 69.6 Plus
Dgri\GH10720-PA 130 GH10720-PA 63..104 39..80 151 69 Plus
Dgri\GH10719-PA 144 GH10719-PA 77..118 39..80 151 66.7 Plus
Dgri\GH11015-PA 170 GH11015-PA 124..170 43..89 143 59.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
Vm32E-PB 116 CG16874-PB 1..116 2..117 616 100 Plus
Vm32E-PA 116 CG16874-PA 1..116 2..117 616 100 Plus
Vm34Ca-PA 119 CG9271-PA 33..116 17..84 227 53.6 Plus
Vm26Ab-PB 168 CG9046-PB 90..160 16..80 211 59.2 Plus
Vm26Ab-PA 168 CG9046-PA 90..160 16..80 211 59.2 Plus
Vm26Aa-PB 141 CG9048-PB 70..126 36..88 192 63.2 Plus
Vm26Aa-PA 141 CG9048-PA 70..126 36..88 192 63.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18220-PA 121 GI18220-PA 73..120 39..86 173 70.8 Plus
Dmoj\GI11326-PA 132 GI11326-PA 63..131 39..109 164 52.1 Plus
Dmoj\GI18145-PA 82 GI18145-PA 6..82 6..94 153 41.3 Plus
Dmoj\GI11336-PA 128 GI11336-PA 59..127 39..109 153 49.3 Plus
Dmoj\GI17534-PA 155 GI17534-PA 109..155 43..89 147 61.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18579-PA 122 GL18579-PA 1..122 2..117 272 64.8 Plus
Dper\GL25706-PA 132 GL25706-PA 84..129 39..84 165 69.6 Plus
Dper\GL19099-PA 147 GL19099-PA 77..130 39..88 165 64.8 Plus
Dper\GL19046-PA 95 GL19046-PA 45..95 39..89 162 62.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14189-PA 124 GA14189-PA 1..124 2..117 270 62.1 Plus
Dpse\GA21501-PA 177 GA21501-PA 125..177 37..89 167 62.3 Plus
Dpse\GA25403-PA 132 GA25403-PA 84..129 39..84 165 69.6 Plus
Dpse\GA21661-PA 132 GA21661-PA 84..129 39..84 165 69.6 Plus
Dpse\GA21503-PA 147 GA21503-PA 77..130 39..88 165 64.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:07:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11107-PA 118 GM11107-PA 1..107 2..106 483 92.5 Plus
Dsec\GM25531-PA 119 GM25531-PA 71..116 39..84 167 69.6 Plus
Dsec\GM17983-PA 141 GM17983-PA 73..126 39..88 166 64.8 Plus
Dsec\GM18584-PA 168 GM18584-PA 119..167 39..87 153 61.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22183-PA 118 GD22183-PA 1..107 2..106 427 93.5 Plus
Dsim\GD22620-PA 141 GD22620-PA 73..126 39..88 166 64.8 Plus
Dsim\GD23372-PA 168 GD23372-PA 119..167 39..87 153 61.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12592-PA 133 GJ12592-PA 64..117 39..88 167 64.8 Plus
Dvir\GJ18127-PA 121 GJ18127-PA 74..119 39..84 164 67.4 Plus
Dvir\GJ12581-PA 140 GJ12581-PA 71..124 39..88 164 64.8 Plus
Dvir\GJ15426-PA 178 GJ15426-PA 128..178 39..89 156 60.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15236-PA 105 GK15236-PA 1..98 2..108 173 44.1 Plus
Dwil\GK15281-PA 111 GK15281-PA 62..110 39..86 162 69.4 Plus
Dwil\GK14709-PA 158 GK14709-PA 109..150 39..80 161 71.4 Plus
Dwil\GK15410-PA 142 GK15410-PA 72..139 39..107 157 55.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12948-PA 115 GE12948-PA 1..104 2..106 351 83.8 Plus
Dyak\GE11602-PA 119 GE11602-PA 71..116 39..84 167 69.6 Plus
Dyak\GE18966-PA 141 GE18966-PA 73..138 40..107 165 57.4 Plus
Dyak\GE25756-PA 167 GE25756-PA 118..166 39..87 153 61.2 Plus