Clone IP02076 Report

Search the DGRC for IP02076

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:20
Well:76
Vector:pOT2
Associated Gene/Transcriptrho-6-RA
Protein status:IP02076.pep: Imported from assembly
Preliminary Size:792
Sequenced Size:911

Clone Sequence Records

IP02076.complete Sequence

911 bp assembled on 2009-02-09

GenBank Submission: BT058101.1

> IP02076.complete
GTTGTCGCCGCCGACTTCGAATCGCATTATGTCTGCCCAAGTGGAGAGCA
ATGGTGCCAGTGAAAGTAATAACAATTGCGTCAAGGATGTCAGGCTCCTG
CTGCTGCCGGAGAATTCCACGGATTCGGATGGCAATCCGGCGAGTGTCGC
ATTCAGTGCGGAATCGCACATTGATGACCTGACACGAACCATTGACGTGG
GCCATGTGAGGAGGAAGCGATTGTGGCGGGTGCCCTGGTTTATTTTGCTG
ATGAGTTTTGTGCAGATATCTTTGCACTGGATAGCTAGTGAGTGTATGCA
AAAAGTACTGATCTTCAAACCGGAATGGAACGTCGAGTACTGGCGCCTAC
TGACCTATATGCTGCTCCATTCCGATTACTGGCATCTGTCTCTCAACATT
TGCTTTCAGTGCTTTATAGGTATCTGCCTGGAAGTGGAGCAGGGTCACTG
GCGTCTGGCCGTGGTCTATATGGTGGGTGGCGTCGCTGGTTCGCTGGCCA
ATGCCTGGCTGCAGCCCCATCTCCATCTGATGGGTGCCTCCGCTGGGGTC
TACGCCATGCTGGGAAGTCATGTGCCGCACCTGGTTCTGAACTTTTCGCA
ATTGTCGCACCGCTTTGCCCGCATCGCCTCCCTGCTGATATTGTTACTCA
GCGATGTGGGCTTTACAACTTACCACTTTTGCCACAATCACAATCGCAAT
CCGCGCACCAGTCTGGAGGCGCATATTGGAGGGGGCGTGGCCGGAATTCT
GTGCGGTTTCATCGTCTATCGACGCCTGCAGCCAGCCAATCAAAAGGCCA
TTTACTTTTAGTCTCAAATAAGATAGTTCCATTCAAATATATATTATATT
TATATCATAGTGAAAAATACGTTTTAAAACAAATTGAAGGCAAAAAAAAA
AAAAAAAAAAA

IP02076.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:22:54
Subject Length Description Subject Range Query Range Score Percent Strand
rho-6.a 1416 rho-6.a 163..886 169..892 3620 100 Plus
rho-6-RB 911 rho-6-RB 239..911 169..841 3365 100 Plus
rho-6-RA 674 rho-6-RA 96..674 263..841 2895 100 Plus
rho-6-RB 911 rho-6-RB 62..231 1..170 850 100 Plus
rho-6.a 1416 rho-6.a 1..155 16..170 775 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 12129160..12129462 891..589 1500 99.7 Minus
chr2L 23010047 chr2L 12131738..12132011 265..1 1200 96.7 Minus
chr2L 23010047 chr2L 12129530..12129712 589..407 915 100 Minus
chr2L 23010047 chr2L 12129936..12130082 409..263 735 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:33:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:27:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12130515..12130818 892..589 1520 100 Minus
2L 23513712 2L 12133094..12133367 265..1 1200 96.7 Minus
2L 23513712 2L 12130886..12131068 589..407 915 100 Minus
2L 23513712 2L 12131292..12131438 409..263 735 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:39:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12130515..12130818 892..589 1520 100 Minus
2L 23513712 2L 12130886..12131068 589..407 915 100 Minus
2L 23513712 2L 12133198..12133367 170..1 850 100 Minus
2L 23513712 2L 12131292..12131438 409..263 735 100 Minus
2L 23513712 2L 12133094..12133190 265..169 485 100 Minus
Blast to na_te.dros performed 2019-03-16 19:27:34
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy 7469 gypsy DMGYPF1A 7469bp Derived from M12927 (g157583) (Rel. 44, Last updated, Version 6). 5936..5973 438..400 111 79.5 Minus

IP02076.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:28:15 Download gff for IP02076.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 12129160..12129461 590..891 92 <- Minus
chr2L 12129530..12129709 410..589 100 <- Minus
chr2L 12129936..12130079 266..409 100 <- Minus
chr2L 12131738..12132011 1..265 96   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:22 Download gff for IP02076.complete
Subject Subject Range Query Range Percent Splice Strand
rho-6-RB 1..792 29..811 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:34:18 Download gff for IP02076.complete
Subject Subject Range Query Range Percent Splice Strand
rho-6-RB 1..792 29..811 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:40:55 Download gff for IP02076.complete
Subject Subject Range Query Range Percent Splice Strand
rho-6-RB 1..792 29..811 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:32:38 Download gff for IP02076.complete
Subject Subject Range Query Range Percent Splice Strand
rho-6-RB 1..792 29..811 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-09 11:53:12 Download gff for IP02076.complete
Subject Subject Range Query Range Percent Splice Strand
rho-6-RB 1..792 29..811 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:34:18 Download gff for IP02076.complete
Subject Subject Range Query Range Percent Splice Strand
rho-6-RB 1..900 1..891 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:40:55 Download gff for IP02076.complete
Subject Subject Range Query Range Percent Splice Strand
rho-6-RB 1..900 1..891 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:32:38 Download gff for IP02076.complete
Subject Subject Range Query Range Percent Splice Strand
rho-6-RB 45..944 1..891 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:28:15 Download gff for IP02076.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12130516..12130817 590..891 100 <- Minus
2L 12130886..12131065 410..589 100 <- Minus
2L 12131292..12131435 266..409 100 <- Minus
2L 12133094..12133367 1..265 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:28:15 Download gff for IP02076.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12130516..12130817 590..891 100 <- Minus
2L 12130886..12131065 410..589 100 <- Minus
2L 12131292..12131435 266..409 100 <- Minus
2L 12133094..12133367 1..265 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:28:15 Download gff for IP02076.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12130516..12130817 590..891 100 <- Minus
2L 12130886..12131065 410..589 100 <- Minus
2L 12131292..12131435 266..409 100 <- Minus
2L 12133094..12133367 1..265 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:40:55 Download gff for IP02076.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12130886..12131065 410..589 100 <- Minus
arm_2L 12131292..12131435 266..409 100 <- Minus
arm_2L 12130516..12130817 590..891 100 <- Minus
arm_2L 12133094..12133367 1..265 96   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:07:38 Download gff for IP02076.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12131292..12131435 266..409 100 <- Minus
2L 12130516..12130817 590..891 100 <- Minus
2L 12130886..12131065 410..589 100 <- Minus
2L 12133094..12133367 1..265 96   Minus

IP02076.hyp Sequence

Translation from 0 to 810

> IP02076.hyp
LSPPTSNRIMSAQVESNGASESNNNCVKDVRLLLLPENSTDSDGNPASVA
FSAESHKKFIDDLTRTIDVGHVRRKRLWRVPWFILLMSFVQISLHWIASE
CMQKVLIFKPEWNVEYWRLLTYMLLHSDYWHLSLNICFQCFIGICLEVEQ
GHWRLAVVYMVGGVAGSLANAWLQPHLHLMGASAGVYAMLGSHVPHLVLN
FSQLSHRFARIASLLILLLSDVGFTTYHFCHNHNRNPRTSLEAHIGGGVA
GILCGFIVYRRLQPANQKAIYF*

IP02076.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
rho-6-PB 263 CG17212-PB 1..263 10..272 1409 100 Plus
rho-6-PC 166 CG17212-PC 1..130 10..139 698 100 Plus
rho-PB 355 CG1004-PB 84..297 63..260 328 32.2 Plus
rho-PA 355 CG1004-PA 84..297 63..260 328 32.2 Plus
ru-PA 341 CG1214-PA 95..284 78..262 317 32.6 Plus

IP02076.pep Sequence

Translation from 1 to 810

> IP02076.pep
LSPPTSNRIMSAQVESNGASESNNNCVKDVRLLLLPENSTDSDGNPASVA
FSAESHIDDLTRTIDVGHVRRKRLWRVPWFILLMSFVQISLHWIASECMQ
KVLIFKPEWNVEYWRLLTYMLLHSDYWHLSLNICFQCFIGICLEVEQGHW
RLAVVYMVGGVAGSLANAWLQPHLHLMGASAGVYAMLGSHVPHLVLNFSQ
LSHRFARIASLLILLLSDVGFTTYHFCHNHNRNPRTSLEAHIGGGVAGIL
CGFIVYRRLQPANQKAIYF*

IP02076.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:59:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15679-PA 260 GF15679-PA 1..260 10..269 935 71.7 Plus
Dana\rho-PA 365 GF24766-PA 48..309 3..259 338 28.9 Plus
Dana\GF24760-PA 352 GF24760-PA 104..295 75..259 296 31.2 Plus
Dana\GF21300-PA 418 GF21300-PA 222..378 102..260 286 34 Plus
Dana\GF25034-PA 485 GF25034-PA 222..431 78..260 273 31 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10271-PA 263 GG10271-PA 1..262 10..268 1245 88.5 Plus
Dere\GG14792-PA 353 GG14792-PA 100..297 78..259 328 33.3 Plus
Dere\GG18433-PA 417 GG18433-PA 221..377 102..260 285 33.8 Plus
Dere\GG14787-PA 349 GG14787-PA 103..293 75..260 274 31.9 Plus
Dere\GG14598-PA 485 GG14598-PA 222..431 78..260 265 28.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 10:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11182-PA 229 GH11182-PA 8..229 22..259 762 63 Plus
Dgri\GH16240-PA 436 GH16240-PA 171..380 78..259 303 30 Plus
Dgri\GH15206-PA 476 GH15206-PA 221..422 78..260 294 31.7 Plus
Dgri\GH16237-PA 321 GH16237-PA 68..263 70..259 289 32.1 Plus
Dgri\GH24104-PA 420 GH24104-PA 224..380 102..260 285 34.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:32
Subject Length Description Subject Range Query Range Score Percent Strand
rho-6-PB 263 CG17212-PB 1..263 10..269 1379 98.9 Plus
rho-6-PC 166 CG17212-PC 1..130 10..136 668 97.7 Plus
rho-PB 355 CG1004-PB 84..297 60..257 328 32.2 Plus
rho-PA 355 CG1004-PA 84..297 60..257 328 32.2 Plus
ru-PA 341 CG1214-PA 95..284 75..259 317 32.6 Plus
rho-4-PB 417 CG1697-PB 221..377 102..260 295 33.3 Plus
rho-4-PA 417 CG1697-PA 221..377 102..260 295 33.3 Plus
stet-PA 330 CG33166-PA 67..276 78..260 264 28.6 Plus
stet-PB 485 CG33166-PB 222..431 78..260 264 28.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 10:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15831-PA 242 GI15831-PA 4..235 20..259 740 62.1 Plus
Dmoj\GI16668-PA 398 GI16668-PA 142..342 78..259 317 31.8 Plus
Dmoj\GI14374-PA 420 GI14374-PA 224..380 102..260 288 34.4 Plus
Dmoj\GI16724-PA 476 GI16724-PA 221..422 78..260 288 31.7 Plus
Dmoj\GI16665-PA 311 GI16665-PA 65..253 76..259 247 33.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:59:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19515-PA 204 GL19515-PA 20..203 28..268 588 56.4 Plus
Dper\GL22503-PA 344 GL22503-PA 100..287 75..259 298 33 Plus
Dper\GL26733-PA 417 GL26733-PA 221..377 102..260 291 34.4 Plus
Dper\GL22587-PA 487 GL22587-PA 223..433 78..260 274 29.4 Plus
Dper\GL22508-PA 342 GL22508-PA 138..284 100..257 199 34 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:59:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14394-PA 252 GA14394-PA 20..252 28..269 855 71.5 Plus
Dpse\GA11431-PA 336 GA11431-PA 55..279 38..259 307 30.7 Plus
Dpse\GA14244-PA 417 GA14244-PA 221..377 102..260 290 34.4 Plus
Dpse\rho-PA 365 GA10027-PA 138..309 100..259 287 32.6 Plus
Dpse\GA17336-PA 487 GA17336-PA 223..433 78..260 270 28.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26295-PA 139 GM26295-PA 1..139 10..141 622 87.1 Plus
Dsec\ve-PA 364 GM14413-PA 93..308 60..259 329 31.9 Plus
Dsec\GM13096-PA 417 GM13096-PA 221..377 102..260 282 33.1 Plus
Dsec\GM14406-PA 344 GM14406-PA 98..287 75..259 275 32.6 Plus
Dsec\GM14213-PA 485 GM14213-PA 222..431 78..260 268 28.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22127-PA 267 GD22127-PA 1..267 10..269 1325 94.8 Plus
Dsim\GD13619-PA 355 GD13619-PA 84..299 60..259 328 31.9 Plus
Dsim\GD17034-PA 382 GD17034-PA 186..342 102..260 285 33.8 Plus
Dsim\GD13615-PA 344 GD13615-PA 98..287 75..259 280 33.2 Plus
Dsim\GD13475-PA 485 GD13475-PA 222..431 78..260 265 28.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 10:59:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10319-PA 246 GJ10319-PA 6..234 20..260 753 62.7 Plus
Dvir\rho-PA 401 GJ12920-PA 145..345 78..259 316 31.3 Plus
Dvir\GJ12468-PA 476 GJ12468-PA 221..422 78..260 285 31.2 Plus
Dvir\GJ12917-PA 314 GJ12917-PA 62..256 70..259 266 33.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:59:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14633-PA 257 GK14633-PA 23..250 28..259 680 59.1 Plus
Dwil\GK16984-PA 391 GK16984-PA 113..335 52..259 330 31.6 Plus
Dwil\GK17206-PA 475 GK17206-PA 220..421 78..260 292 32.2 Plus
Dwil\GK15930-PA 418 GK15930-PA 224..378 104..260 291 35.4 Plus
Dwil\GK16979-PA 315 GK16979-PA 69..241 73..242 289 34.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:59:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12391-PA 263 GE12391-PA 1..263 10..269 1199 89.4 Plus
Dyak\GE21154-PA 355 GE21154-PA 102..299 78..259 325 33.3 Plus
Dyak\GE15951-PA 417 GE15951-PA 221..377 102..260 286 33.8 Plus
Dyak\GE21150-PA 343 GE21150-PA 79..286 65..259 282 32.2 Plus
Dyak\GE20958-PA 485 GE20958-PA 222..431 78..260 265 28.6 Plus