Clone IP02082 Report

Search the DGRC for IP02082

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:20
Well:82
Vector:pOT2
Associated Gene/TranscriptSer12-RA
Protein status:IP02082.pep: gold
Preliminary Size:738
Sequenced Size:863

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17240 2005-01-01 Successful iPCR screen
Ser12 2008-04-29 Release 5.5 accounting
Ser12 2008-08-15 Release 5.9 accounting
Ser12 2008-12-18 5.12 accounting

Clone Sequence Records

IP02082.complete Sequence

863 bp (863 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023348

> IP02082.complete
TCGCAATGCTCCTCCACTGGCTTGTTCTGGTCGCCAGCGTCACCCTGATC
TCGGCAGGATCTTCTCCGGAGCGAATAGTGGGTGGCCACCCTGTGCTTAT
TTCAGAAGTTCCTTGGCAGGCGGCTCTCATGTATTCGGAAAAATACATTT
GCGGTGCAGTTATCTACAGTGACAAGATCATTATAACAGCAGCCCACTGT
GTTGAAAGACCCTTCGATACACTGTATTCCGTCAGAGTTGGATCCGTATG
GAAAAACTTGGGTGGACAGCACGCCAGGGTTGCTGTAATTCGGAAGCATG
AAGACTACGTATCTTCCACCATTTTGTTCAACGATATAGCCGTAATTAGA
CTGGTGGACACTCTAATTTTCAATGCCGAAGTAAGACCTATCCAACTGGC
CGATAGTGCACCCGCAGCTGGAACTGAAGCTTCGGTTTCTGGTTGGGGAG
AAATCGGAATCCTCTGGCTACAACCTACATCTCTATTGAAAACCTCAGTG
AAAATACTAGACCCGAATGTTTGTAAGCGGTCCTATCAGTACATCACCAA
AACTATGATTTGCGCCGCCGCTCTCTTAAAAGATTCCTGTCATGGAGACT
CCGGCGGACCTCTCGTCTCCGGTGGCCAACTAGTTGGCATTGTCTCCTAC
GGCATTGGATGCGCCAATCCGTTCTTTCCCGGAGTCTACGCCAATGTGGC
TGAGCTGAAACCTTGGATCTTAAATGCTATTGAACAGCTTTAAGTATAAG
CATACGATTCAAGACAACTACTTAACTATTTAGCATTTGTAAAAATACTT
ATGACATTTATATTGACATCTTAATAGATACATTTTAAAGCATTTAAAAA
AAAAAAAAAAAAA

IP02082.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Ser12-RA 845 Ser12-RA 1..845 1..845 4225 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:36:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2250176..2250991 845..31 3970 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:33:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:36:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2250428..2251275 848..1 4240 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:43:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2250428..2251275 848..1 4240 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:36:17 has no hits.

IP02082.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:37:00 Download gff for IP02082.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2250176..2251012 1..845 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:16:38 Download gff for IP02082.complete
Subject Subject Range Query Range Percent Splice Strand
Ser12-RA 1..738 6..743 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:26:55 Download gff for IP02082.complete
Subject Subject Range Query Range Percent Splice Strand
Ser12-RA 1..738 6..743 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:08:24 Download gff for IP02082.complete
Subject Subject Range Query Range Percent Splice Strand
Ser12-RA 1..738 6..743 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:10:56 Download gff for IP02082.complete
Subject Subject Range Query Range Percent Splice Strand
Ser12-RA 1..738 6..743 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:34:44 Download gff for IP02082.complete
Subject Subject Range Query Range Percent Splice Strand
Ser12-RA 1..738 6..743 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:29:55 Download gff for IP02082.complete
Subject Subject Range Query Range Percent Splice Strand
Ser12-RA 1..738 6..743 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:26:55 Download gff for IP02082.complete
Subject Subject Range Query Range Percent Splice Strand
Ser12-RA 1..845 1..845 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:08:24 Download gff for IP02082.complete
Subject Subject Range Query Range Percent Splice Strand
Ser12-RA 1..845 1..845 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:10:56 Download gff for IP02082.complete
Subject Subject Range Query Range Percent Splice Strand
Ser12-RA 1..738 6..743 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:34:44 Download gff for IP02082.complete
Subject Subject Range Query Range Percent Splice Strand
Ser12-RA 1..845 1..845 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:37:00 Download gff for IP02082.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2250431..2251275 1..845 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:37:00 Download gff for IP02082.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2250431..2251275 1..845 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:37:00 Download gff for IP02082.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2250431..2251275 1..845 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:08:24 Download gff for IP02082.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2250431..2251275 1..845 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:47:29 Download gff for IP02082.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2250431..2251275 1..845 100   Minus

IP02082.hyp Sequence

Translation from 2 to 742

> IP02082.hyp
AMLLHWLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYIC
GAVIYSDKIIITAAHCVERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHE
DYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSAPAAGTEASVSGWGE
IGILWLQPTSLLKTSVKILDPNVCKRSYQYITKTMICAAALLKDSCHGDS
GGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAIEQL*

IP02082.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:43:41
Subject Length Description Subject Range Query Range Score Percent Strand
Ser12-PA 245 CG17240-PA 1..245 2..246 1269 100 Plus
CG17239-PB 248 CG17239-PB 1..244 2..246 630 54.1 Plus
CG17239-PA 248 CG17239-PA 1..244 2..246 630 54.1 Plus
CG30025-PA 253 CG30025-PA 1..251 3..241 492 43.3 Plus
betaTry-PB 253 CG18211-PB 1..251 3..241 491 44.4 Plus

IP02082.pep Sequence

Translation from 5 to 742

> IP02082.pep
MLLHWLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICG
AVIYSDKIIITAAHCVERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHED
YVSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSAPAAGTEASVSGWGEI
GILWLQPTSLLKTSVKILDPNVCKRSYQYITKTMICAAALLKDSCHGDSG
GPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAIEQL*

IP02082.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15291-PA 246 GF15291-PA 2..246 1..245 619 52.8 Plus
Dana\GF13692-PA 261 GF13692-PA 34..257 23..241 482 47.6 Plus
Dana\GF12402-PA 256 GF12402-PA 1..256 2..245 467 41.9 Plus
Dana\GF12546-PA 256 GF12546-PA 1..256 2..245 431 42.4 Plus
Dana\GF12403-PA 256 GF12403-PA 1..256 2..245 429 42.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:21:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24539-PA 247 GG24539-PA 1..247 1..245 993 76.1 Plus
Dere\GG24538-PA 227 GG24538-PA 1..227 1..245 588 51.6 Plus
Dere\GG20381-PA 259 GG20381-PA 33..255 23..241 486 46.4 Plus
Dere\betaTry-PA 253 GG20194-PA 1..251 2..240 448 44.4 Plus
Dere\epsilonTry-PA 256 GG22660-PA 1..256 2..245 434 39.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:21:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22924-PA 256 GH22924-PA 30..251 23..240 496 47.1 Plus
Dgri\GH22925-PA 254 GH22925-PA 30..251 23..240 492 48.4 Plus
Dgri\GH22926-PA 256 GH22926-PA 30..251 23..240 490 46.2 Plus
Dgri\GH22866-PA 255 GH22866-PA 1..255 2..245 488 41.4 Plus
Dgri\GH22927-PA 256 GH22927-PA 1..251 2..240 459 42.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
Ser12-PA 245 CG17240-PA 1..245 1..245 1269 100 Plus
CG17239-PB 248 CG17239-PB 1..244 1..245 630 54.1 Plus
CG17239-PA 248 CG17239-PA 1..244 1..245 630 54.1 Plus
CG30025-PA 253 CG30025-PA 1..251 2..240 492 43.3 Plus
betaTry-PB 253 CG18211-PB 1..251 2..240 491 44.4 Plus
betaTry-PA 253 CG18211-PA 1..251 2..240 491 44.4 Plus
alphaTry-PA 256 CG18444-PA 1..256 2..245 489 43.8 Plus
gammaTry-PA 253 CG30028-PA 1..251 2..240 487 42.9 Plus
deltaTry-PA 253 CG12351-PA 1..251 2..240 487 42.9 Plus
CG30031-PA 253 CG30031-PA 1..251 2..240 487 42.9 Plus
Ser8-PA 260 CG4812-PA 11..256 6..241 473 42.9 Plus
iotaTry-PA 252 CG7754-PA 1..248 1..241 452 42.8 Plus
epsilonTry-PA 256 CG18681-PA 1..256 2..245 446 41.1 Plus
CG17571-PB 258 CG17571-PB 30..258 23..245 414 39.6 Plus
CG17571-PA 258 CG17571-PA 30..258 23..245 414 39.6 Plus
CG13430-PB 267 CG13430-PB 13..266 5..245 410 39.4 Plus
CG13430-PA 267 CG13430-PA 13..266 5..245 410 39.4 Plus
Send2-PA 239 CG18125-PA 1..232 1..245 394 39.9 Plus
CG11192-PB 279 CG11192-PB 7..259 3..238 393 38.4 Plus
CG17234-PA 251 CG17234-PA 1..250 1..245 389 38.4 Plus
thetaTry-PA 262 CG12385-PA 34..262 23..245 379 39.1 Plus
CG31681-PA 264 CG31681-PA 5..255 1..244 375 39.5 Plus
CG16998-PA 258 CG16998-PA 17..247 16..243 366 37.6 Plus
Send1-PA 255 CG17012-PA 28..246 22..245 348 38.8 Plus
zetaTry-PA 280 CG12387-PA 38..273 23..238 345 37.3 Plus
l(2)k05911-PC 639 CG31728-PC 398..639 22..243 345 38.5 Plus
CG32376-PA 291 CG32376-PA 61..290 19..244 344 37.4 Plus
CG33159-PA 257 CG33159-PA 6..240 2..232 342 37.1 Plus
CG8299-PA 260 CG8299-PA 7..252 3..238 338 35.2 Plus
CG10405-PB 268 CG10405-PB 18..262 6..238 335 35.9 Plus
CG31954-PA 277 CG31954-PA 50..271 23..238 329 37.5 Plus
lambdaTry-PA 272 CG12350-PA 35..260 23..242 321 35.7 Plus
CG32755-PA 315 CG32755-PA 37..274 23..241 320 34.4 Plus
CG17242-PA 245 CG17242-PA 1..237 1..243 318 34.1 Plus
CG17242-PB 245 CG17242-PB 1..237 1..243 318 34.1 Plus
etaTry-PA 262 CG12386-PA 21..254 17..238 315 36.6 Plus
CG11836-PI 281 CG11836-PI 44..275 23..243 315 35.7 Plus
CG11836-PJ 333 CG11836-PJ 96..327 23..243 315 35.7 Plus
CG7829-PA 253 CG7829-PA 5..245 3..238 314 34.7 Plus
Try29F-PD 267 CG9564-PD 41..261 23..238 309 35.4 Plus
Try29F-PC 267 CG9564-PC 41..261 23..238 309 35.4 Plus
CG9676-PA 251 CG9676-PA 1..245 1..238 308 35.3 Plus
CG4914-PA 374 CG4914-PA 127..361 23..239 306 34.6 Plus
CG32374-PA 299 CG32374-PA 71..292 21..238 304 36 Plus
CG32271-PA 248 CG32271-PA 5..246 5..242 303 34.8 Plus
CG32833-PA 268 CG32833-PA 39..265 25..240 303 31.6 Plus
CG18735-PA 364 CG18735-PA 82..311 23..238 300 36.5 Plus
CG11037-PA 292 CG11037-PA 61..288 23..245 299 36 Plus
CG4386-PA 372 CG4386-PA 125..360 22..244 299 33.8 Plus
CG33160-PA 258 CG33160-PA 33..256 23..244 296 35.6 Plus
CG32523-PA 262 CG32523-PA 36..256 23..238 286 34.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:21:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21243-PA 255 GI21243-PA 1..255 2..245 481 42.2 Plus
Dmoj\GI18353-PA 254 GI18353-PA 1..249 1..239 425 38.4 Plus
Dmoj\GI20607-PA 261 GI20607-PA 34..261 22..245 422 41.1 Plus
Dmoj\GI18352-PA 287 GI18352-PA 32..285 1..244 420 38.5 Plus
Dmoj\GI18354-PA 254 GI18354-PA 1..249 1..239 417 39.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:21:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17339-PA 256 GL17339-PA 1..256 2..245 482 43.6 Plus
Dper\GL17142-PA 256 GL17142-PA 1..256 2..245 459 44.4 Plus
Dper\GL17338-PA 256 GL17338-PA 1..256 2..245 459 41.9 Plus
Dper\GL17143-PA 256 GL17143-PA 1..256 2..245 445 43.6 Plus
Dper\GL26041-PA 259 GL26041-PA 31..259 23..245 439 42.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:21:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14937-PA 256 GA14937-PA 1..256 2..245 482 43.6 Plus
Dpse\GA15051-PA 256 GA15051-PA 1..256 2..245 470 42.2 Plus
Dpse\GA24979-PA 256 GA24979-PA 1..256 2..245 463 44.7 Plus
Dpse\GA24980-PA 256 GA24980-PA 1..256 2..245 444 43.6 Plus
Dpse\GA20562-PA 252 GA20562-PA 19..248 16..241 435 42.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:21:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18246-PA 248 GM18246-PA 1..244 1..245 641 55.7 Plus
Dsec\GM21468-PA 260 GM21468-PA 34..256 23..241 493 46.9 Plus
Dsec\GM21283-PA 266 GM21283-PA 1..262 2..241 418 41.3 Plus
Dsec\GM20441-PA 256 GM20441-PA 1..256 2..245 414 43.8 Plus
Dsec\GM19780-PA 267 GM19780-PA 24..266 16..245 410 40.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:21:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22853-PA 245 GD22853-PA 1..245 1..245 1136 88.2 Plus
Dsim\GD22852-PA 248 GD22852-PA 1..244 1..245 620 54.5 Plus
Dsim\GD15412-PA 260 GD15412-PA 34..256 23..241 492 46.4 Plus
Dsim\GD15391-PA 253 GD15391-PA 1..251 2..240 431 42.5 Plus
Dsim\GD21711-PA 258 GD21711-PA 30..258 23..245 415 38.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21575-PA 256 GJ21575-PA 31..255 23..245 476 46.3 Plus
Dvir\GJ21498-PA 256 GJ21498-PA 30..250 23..239 472 48.9 Plus
Dvir\GJ20754-PA 253 GJ20754-PA 10..250 6..245 464 42.7 Plus
Dvir\GJ21048-PA 259 GJ21048-PA 7..259 1..245 461 41.7 Plus
Dvir\Try1-PA 256 GJ21500-PA 30..251 23..240 447 50.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21994-PA 256 GK21994-PA 1..256 2..245 472 42.6 Plus
Dwil\GK21995-PA 256 GK21995-PA 30..256 23..245 461 45.6 Plus
Dwil\GK19007-PA 261 GK19007-PA 13..257 6..241 455 44.8 Plus
Dwil\GK19676-PA 244 GK19676-PA 18..244 23..245 449 49.1 Plus
Dwil\GK24139-PA 259 GK24139-PA 4..256 2..245 447 40.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:22:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15159-PA 244 GE15159-PA 1..244 1..245 943 73.9 Plus
Dyak\GE15166-PA 244 GE15166-PA 1..244 1..245 623 52 Plus
Dyak\GE15156-PA 244 GE15156-PA 1..244 1..245 619 51.6 Plus
Dyak\GE12542-PA 259 GE12542-PA 33..255 23..241 495 47.3 Plus
Dyak\epsilonTry-PA 256 GE13534-PA 1..256 2..245 455 40.7 Plus