Clone IP02091 Report

Search the DGRC for IP02091

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:20
Well:91
Vector:pOT2
Associated Gene/TranscriptOr42a-RA
Protein status:IP02091.pep: gold
Preliminary Size:1221
Sequenced Size:1300

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17250 2005-01-01 Successful iPCR screen
Or42a 2008-04-29 Release 5.5 accounting
Or42a 2008-08-15 Release 5.9 accounting
Or42a 2008-12-18 5.12 accounting

Clone Sequence Records

IP02091.complete Sequence

1300 bp (1300 high quality bases) assembled on 2006-01-20

GenBank Submission: BT024437

> IP02091.complete
CACTATGGATCTGCGAAGGTGGTTTCCGACCTTGTACACCCAGTCGAAGG
ATTCGCCAGTTCGCTCCCGAGACGCGACCCTGTACCTCCTACGCTGCGTC
TTCTTAATGGGCGTCCGCAAGCCACCTGCCAAGTTTTTCGTGGCCTACGT
GCTCTGGTCCTTCGCACTGAATTTCTGCTCAACATTTTATCAGCCAATTG
GCTTTCTCACAGGCTATATAAGCCATTTATCAGAGTTCTCCCCGGGAGAG
TTTCTAACTTCGCTGCAGGTGGCCTTTAATGCTTGGTCCTGCTCTACAAA
AGTCCTGATAGTGTGGGCACTAGTTAAGCGCTTTGACGAGGCTAATAACC
TTCTCGACGAGATGGATAGGCGTATCACAGACCCCGGAGAGCGTCTTCAG
ATTCATCGCGCTGTCTCCCTCAGTAACCGTATATTCTTCTTTTTCATGGC
AGTCTACATGGTTTATGCCACTAATACGTTTCTGTCGGCGATCTTCATTG
GAAGGCCACCGTACCAAAATTACTACCCTTTTCTGGACTGGCGATCTAGC
ACTCTGCATCTAGCTCTGCAGGCCGGTCTGGAATACTTCGCCATGGCTGG
CGCCTGCTTCCAGGACGTTTGCGTTGATTGCTACCCAGTCAATTTCGTTT
TGGTCCTGCGTGCCCACATGTCGATCTTCGCGGAGCGCCTTCGACGTTTG
GGAACTTATCCTTATGAAAGCCAGGAGCAGAAATATGAACGATTGGTTCA
GTGCATACAAGATCACAAAGTAATTTTGCGATTTGTTGACTGCCTGCGTC
CTGTTATTTCTGGTACCATCTTCGTGCAATTCTTGGTTGTGGGGTTGGTG
CTGGGCTTTACCCTAATTAACATTGTCCTGTTCGCCAACTTGGGATCGGC
CATCGCAGCGCTCTCGTTTATGGCCGCAGTGCTTCTAGAGACGACTCCCT
TCTGCATATTGTGCAATTATCTCACAGAAGACTGCTACAAGCTGGCCGAT
GCCCTGTTTCAGTCAAACTGGATTGATGAGGAGAAACGATACCAAAAGAC
ACTCATGTACTTCCTACAGAAACTGCAGCAGCCTATAACCTTCATGGCTA
TGAACGTGTTTCCAATATCTGTGGGAACTAACATCAGTGTCACAAAATTT
TCGTTCTCCGTCTTTACTCTCGTAAAACAAATGAACATATCTGAGAAACT
TGCCAAATCTGAAATGGAAGAGTGAAAAAGTTTATTCGAATTTAAAATCA
CACATGAAAGAAATTAAAGTACACGGTAATAAAAAAAAAAAAAAAAAAAA

IP02091.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
Or42a-RA 1280 Or42a-RA 1..1280 1..1280 6400 100 Plus
nc_4550.a 782 nc_4550.a 1..392 392..1 1960 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:06:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 1679575..1680354 780..1 3900 100 Minus
chr2R 21145070 chr2R 1679030..1679390 1140..780 1805 100 Minus
chr2R 21145070 chr2R 1678828..1678969 1280..1139 710 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:33:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:06:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5792188..5792967 780..1 3900 100 Minus
2R 25286936 2R 5791643..5792003 1140..780 1805 100 Minus
2R 25286936 2R 5791437..5791582 1284..1139 730 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:14:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 5793387..5794166 780..1 3900 100 Minus
2R 25260384 2R 5792842..5793202 1140..780 1805 100 Minus
2R 25260384 2R 5792636..5792781 1284..1139 730 100 Minus
Blast to na_te.dros performed 2019-03-16 10:06:07
Subject Length Description Subject Range Query Range Score Percent Strand
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 3960..4048 1171..1261 117 62 Plus

IP02091.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:06:50 Download gff for IP02091.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 1678828..1678969 1139..1280 100 <- Minus
chr2R 1679032..1679389 781..1138 100 <- Minus
chr2R 1679575..1680354 1..780 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:16:44 Download gff for IP02091.complete
Subject Subject Range Query Range Percent Splice Strand
Or42a-RA 1..1221 5..1225 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:38:15 Download gff for IP02091.complete
Subject Subject Range Query Range Percent Splice Strand
Or42a-RA 1..1221 5..1225 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:55:56 Download gff for IP02091.complete
Subject Subject Range Query Range Percent Splice Strand
Or42a-RA 1..1221 5..1225 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:13:16 Download gff for IP02091.complete
Subject Subject Range Query Range Percent Splice Strand
Or42a-RA 1..1221 5..1225 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:55:32 Download gff for IP02091.complete
Subject Subject Range Query Range Percent Splice Strand
Or42a-RA 1..1221 5..1225 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:10:06 Download gff for IP02091.complete
Subject Subject Range Query Range Percent Splice Strand
Or42a-RA 1..1221 5..1225 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:38:15 Download gff for IP02091.complete
Subject Subject Range Query Range Percent Splice Strand
Or42a-RA 1..1280 1..1280 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:55:56 Download gff for IP02091.complete
Subject Subject Range Query Range Percent Splice Strand
Or42a-RA 1..1280 1..1280 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:13:16 Download gff for IP02091.complete
Subject Subject Range Query Range Percent Splice Strand
Or42a-RA 1..1221 5..1225 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:55:32 Download gff for IP02091.complete
Subject Subject Range Query Range Percent Splice Strand
Or42a-RA 1..1280 1..1280 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:06:50 Download gff for IP02091.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5791441..5791582 1139..1280 100 <- Minus
2R 5791645..5792002 781..1138 100 <- Minus
2R 5792188..5792967 1..780 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:06:50 Download gff for IP02091.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5791441..5791582 1139..1280 100 <- Minus
2R 5791645..5792002 781..1138 100 <- Minus
2R 5792188..5792967 1..780 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:06:50 Download gff for IP02091.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5791441..5791582 1139..1280 100 <- Minus
2R 5791645..5792002 781..1138 100 <- Minus
2R 5792188..5792967 1..780 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:55:56 Download gff for IP02091.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1678946..1679087 1139..1280 100 <- Minus
arm_2R 1679150..1679507 781..1138 100 <- Minus
arm_2R 1679693..1680472 1..780 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:01:14 Download gff for IP02091.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5793387..5794166 1..780 100   Minus
2R 5792844..5793201 781..1138 100 <- Minus
2R 5792640..5792781 1139..1280 100 <- Minus

IP02091.hyp Sequence

Translation from 0 to 1224

> IP02091.hyp
TMDLRRWFPTLYTQSKDSPVRSRDATLYLLRCVFLMGVRKPPAKFFVAYV
LWSFALNFCSTFYQPIGFLTGYISHLSEFSPGEFLTSLQVAFNAWSCSTK
VLIVWALVKRFDEANNLLDEMDRRITDPGERLQIHRAVSLSNRIFFFFMA
VYMVYATNTFLSAIFIGRPPYQNYYPFLDWRSSTLHLALQAGLEYFAMAG
ACFQDVCVDCYPVNFVLVLRAHMSIFAERLRRLGTYPYESQEQKYERLVQ
CIQDHKVILRFVDCLRPVISGTIFVQFLVVGLVLGFTLINIVLFANLGSA
IAALSFMAAVLLETTPFCILCNYLTEDCYKLADALFQSNWIDEEKRYQKT
LMYFLQKLQQPITFMAMNVFPISVGTNISVTKFSFSVFTLVKQMNISEKL
AKSEMEE*

IP02091.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:43:58
Subject Length Description Subject Range Query Range Score Percent Strand
Or42a-PA 406 CG17250-PA 1..406 2..407 2116 100 Plus
Or42b-PA 399 CG12754-PA 16..395 21..399 955 47.9 Plus
Or59b-PA 398 CG3569-PA 16..396 20..399 845 42 Plus
Or43b-PA 403 CG17853-PA 5..403 8..404 753 36.8 Plus
Or22a-PA 397 CG12193-PA 2..395 4..399 738 37.3 Plus

IP02091.pep Sequence

Translation from 4 to 1224

> IP02091.pep
MDLRRWFPTLYTQSKDSPVRSRDATLYLLRCVFLMGVRKPPAKFFVAYVL
WSFALNFCSTFYQPIGFLTGYISHLSEFSPGEFLTSLQVAFNAWSCSTKV
LIVWALVKRFDEANNLLDEMDRRITDPGERLQIHRAVSLSNRIFFFFMAV
YMVYATNTFLSAIFIGRPPYQNYYPFLDWRSSTLHLALQAGLEYFAMAGA
CFQDVCVDCYPVNFVLVLRAHMSIFAERLRRLGTYPYESQEQKYERLVQC
IQDHKVILRFVDCLRPVISGTIFVQFLVVGLVLGFTLINIVLFANLGSAI
AALSFMAAVLLETTPFCILCNYLTEDCYKLADALFQSNWIDEEKRYQKTL
MYFLQKLQQPITFMAMNVFPISVGTNISVTKFSFSVFTLVKQMNISEKLA
KSEMEE*

IP02091.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:22:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11032-PA 407 GF11032-PA 4..407 3..406 1917 87.6 Plus
Dana\GF13833-PA 399 GF13833-PA 15..398 19..401 983 47.7 Plus
Dana\GF11847-PA 398 GF11847-PA 16..396 19..398 882 43.7 Plus
Dana\GF11845-PA 410 GF11845-PA 16..398 19..398 788 39.9 Plus
Dana\GF11232-PA 403 GF11232-PA 8..403 10..403 730 37 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:22:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10847-PA 406 GG10847-PA 1..406 1..406 2001 92.1 Plus
Dere\GG10846-PA 399 GG10846-PA 16..395 20..398 974 48.4 Plus
Dere\GG20029-PA 398 GG20029-PA 16..396 19..398 862 42.9 Plus
Dere\GG20028-PA 410 GG20028-PA 1..398 3..398 784 37.9 Plus
Dere\GG24797-PA 397 GG24797-PA 5..395 10..398 720 37.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:22:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21457-PA 405 GH21457-PA 1..403 1..403 1524 69 Plus
Dgri\GH20416-PA 399 GH20416-PA 15..395 19..398 951 47.5 Plus
Dgri\GH20413-PA 399 GH20413-PA 15..395 19..398 939 45.8 Plus
Dgri\GH20412-PA 399 GH20412-PA 15..395 19..398 929 45.5 Plus
Dgri\GH24321-PA 399 GH24321-PA 15..396 19..399 895 44.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
Or42a-PA 406 CG17250-PA 1..406 1..406 2116 100 Plus
Or42b-PA 399 CG12754-PA 16..395 20..398 955 47.9 Plus
Or59b-PA 398 CG3569-PA 16..396 19..398 845 42 Plus
Or43b-PA 403 CG17853-PA 5..403 7..403 753 36.8 Plus
Or22b-PA 397 CG4231-PA 2..395 3..398 738 37.8 Plus
Or22a-PA 397 CG12193-PA 2..395 3..398 738 37.3 Plus
Or59c-PA 411 CG17226-PA 5..399 6..398 718 36.2 Plus
Or98a-PA 397 CG5540-PA 17..397 21..402 686 35.3 Plus
Or85a-PA 397 CG7454-PA 16..396 20..401 683 35.2 Plus
Or7a-PA 413 CG10759-PA 9..412 14..402 619 33.8 Plus
Or2a-PA 397 CG3206-PA 3..393 13..390 314 24.7 Plus
Or23a-PA 379 CG9880-PA 33..371 51..390 285 23.4 Plus
Or33a-PA 378 CG16960-PA 66..378 86..395 266 24.3 Plus
Or33b-PA 379 CG16961-PA 28..378 42..393 258 23 Plus
Or59a-PA 379 CG9820-PA 36..377 48..393 249 25.2 Plus
Or19a-PB 387 CG18859-PB 4..381 17..393 214 23.1 Plus
Or19b-PA 387 CG32825-PA 4..381 17..393 210 22.9 Plus
Or33c-PA 384 CG5006-PA 60..378 79..390 207 23.5 Plus
Or43a-PA 376 CG1854-PA 200..371 219..391 188 23.1 Plus
Or30a-PA 377 CG13106-PA 153..375 169..393 171 20.4 Plus
Or71a-PB 378 CG17871-PB 125..377 141..394 156 23.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:22:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19935-PA 408 GI19935-PA 1..408 1..406 1452 68.1 Plus
Dmoj\GI19947-PA 413 GI19947-PA 1..402 1..402 1427 62.9 Plus
Dmoj\GI19601-PA 399 GI19601-PA 2..395 10..398 953 47 Plus
Dmoj\GI19019-PA 399 GI19019-PA 17..397 19..398 862 42.3 Plus
Dmoj\GI17082-PA 400 GI17082-PA 2..397 3..398 796 39.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:22:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20053-PA 407 GL20053-PA 1..405 1..405 1867 84.7 Plus
Dper\GL20052-PA 409 GL20052-PA 1..405 1..405 1760 79.5 Plus
Dper\GL20054-PA 399 GL20054-PA 15..395 19..398 960 48.2 Plus
Dper\GL17559-PA 398 GL17559-PA 16..396 19..398 863 43.2 Plus
Dper\GL10387-PA 407 GL10387-PA 2..397 6..399 778 39.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:22:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Or42a2-PA 407 GA14414-PA 1..405 1..405 1874 85.2 Plus
Dpse\Or42a1-PA 409 GA24267-PA 1..405 1..405 1777 80.7 Plus
Dpse\Or42b-PA 399 GA11791-PA 15..395 19..398 966 47.8 Plus
Dpse\Or59b-PA 398 GA17527-PA 16..396 19..398 861 42.8 Plus
Dpse\Or43b-PA 407 GA14700-PA 2..397 6..399 777 39.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:22:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16497-PA 406 GM16497-PA 1..406 1..406 2114 96.8 Plus
Dsec\GM16496-PA 399 GM16496-PA 16..395 20..398 978 48.7 Plus
Dsec\GM15541-PA 398 GM15541-PA 16..396 19..398 855 42.7 Plus
Dsec\GM15540-PA 411 GM15540-PA 6..399 7..398 743 37.1 Plus
Dsec\GM20747-PA 403 GM20747-PA 5..403 7..403 740 38 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:22:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10348-PA 406 GD10348-PA 1..406 1..406 2145 98 Plus
Dsim\GD10347-PA 422 GD10347-PA 39..418 20..398 973 48.4 Plus
Dsim\GD25045-PA 398 GD25045-PA 16..396 19..398 855 42.7 Plus
Dsim\GD25044-PA 411 GD25044-PA 6..399 7..398 748 37.1 Plus
Dsim\GD10213-PA 403 GD10213-PA 5..403 7..403 744 37.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17804-PA 412 GJ17804-PA 1..402 1..402 1522 68.4 Plus
Dvir\GJ15103-PA 409 GJ15103-PA 1..407 1..406 1440 67.1 Plus
Dvir\GJ15102-PA 387 GJ15102-PA 1..387 1..406 1281 62.2 Plus
Dvir\GJ18409-PA 400 GJ18409-PA 15..396 19..398 966 48.4 Plus
Dvir\GJ10682-PA 400 GJ10682-PA 16..398 17..398 864 43.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21762-PA 410 GK21762-PA 1..405 1..405 1803 81.5 Plus
Dwil\GK21759-PA 399 GK21759-PA 4..395 2..398 955 47.4 Plus
Dwil\GK23054-PA 398 GK23054-PA 16..396 19..398 868 43.2 Plus
Dwil\GK23053-PA 404 GK23053-PA 5..404 10..403 849 40.1 Plus
Dwil\GK14943-PA 400 GK14943-PA 6..400 7..400 802 40.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:22:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11311-PA 406 GE11311-PA 1..406 1..406 2039 93.3 Plus
Dyak\GE19440-PA 399 GE19440-PA 16..395 20..398 979 48.7 Plus
Dyak\GE11565-PA 398 GE11565-PA 16..396 19..398 858 42.7 Plus
Dyak\GE11564-PA 411 GE11564-PA 6..399 7..398 753 37.2 Plus
Dyak\GE17626-PA 397 GE17626-PA 2..395 3..398 730 37.3 Plus