Clone IP02110 Report

Search the DGRC for IP02110

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:21
Well:10
Vector:pOT2
Associated Gene/TranscriptAcp70A-RA
Protein status:IP02110.pep: validated not full length
Preliminary Size:223
Sequenced Size:237

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17673 2005-01-01 Successful iPCR screen
Acp70A 2008-04-29 Release 5.5 accounting
Acp70A 2008-08-15 Release 5.9 accounting
Acp70A 2008-12-18 5.12 accounting

Clone Sequence Records

IP02110.complete Sequence

237 bp (237 high quality bases) assembled on 2005-03-04

GenBank Submission: BT023349

> IP02110.complete
CTCTAGCTCTATTCTTGGTTCTCGTTTGCGTACTCGGCTTGGTCCAGGCC
TGGGAATGGCCGTGGAATAGGAAGCCTACAAAGTTTCCAATTCCAAGCCC
CAATCCTCGTGATAAGTGGTGCCGTCTTAATTTGGGGCCCGCCTGGGGTG
GAAGATGTTAAGATATGAATATTTGAGCTTAATATAAAATAAACCCACCC
ACCAAAATGTCTTAAAAAAAAAAAAAAAAAAAAAAAA

IP02110.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
Acp70A-RA 307 Acp70A-RA 27..243 1..217 1085 100 Plus
Acp70A.a 252 Acp70A.a 139..247 109..217 545 100 Plus
Acp70A.a 252 Acp70A.a 11..118 1..108 540 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13291893..13292002 1..110 550 100 Plus
chr3L 24539361 chr3L 13292066..13292170 109..213 525 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:33:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:32:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13301645..13301754 1..110 550 100 Plus
3L 28110227 3L 13301818..13301926 109..217 545 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:42:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13294745..13294854 1..110 550 100 Plus
3L 28103327 3L 13294918..13295026 109..217 545 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:32:32 has no hits.

IP02110.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:33:19 Download gff for IP02110.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13291893..13292000 1..108 100 -> Plus
chr3L 13292066..13292170 109..213 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:16:49 Download gff for IP02110.complete
Subject Subject Range Query Range Percent Splice Strand
Acp70A-RA 8..168 1..161 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:25:45 Download gff for IP02110.complete
Subject Subject Range Query Range Percent Splice Strand
Acp70A-RA 8..168 1..161 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:19:47 Download gff for IP02110.complete
Subject Subject Range Query Range Percent Splice Strand
Acp70A-RA 8..168 1..161 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:09:52 Download gff for IP02110.complete
Subject Subject Range Query Range Percent Splice Strand
Acp70A-RA 8..168 1..161 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:21:18 Download gff for IP02110.complete
Subject Subject Range Query Range Percent Splice Strand
SP-RA 8..168 1..161 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:28:17 Download gff for IP02110.complete
Subject Subject Range Query Range Percent Splice Strand
Acp70A-RA 11..223 1..213 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:25:45 Download gff for IP02110.complete
Subject Subject Range Query Range Percent Splice Strand
Acp70A-RA 11..223 1..213 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:19:47 Download gff for IP02110.complete
Subject Subject Range Query Range Percent Splice Strand
Acp70A-RA 11..223 1..213 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:09:52 Download gff for IP02110.complete
Subject Subject Range Query Range Percent Splice Strand
Acp70A-RA 11..223 1..213 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:21:18 Download gff for IP02110.complete
Subject Subject Range Query Range Percent Splice Strand
SP-RA 11..223 1..213 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:33:19 Download gff for IP02110.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13301645..13301752 1..108 100 -> Plus
3L 13301818..13301922 109..213 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:33:19 Download gff for IP02110.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13301645..13301752 1..108 100 -> Plus
3L 13301818..13301922 109..213 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:33:19 Download gff for IP02110.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13301645..13301752 1..108 100 -> Plus
3L 13301818..13301922 109..213 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:19:47 Download gff for IP02110.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13294745..13294852 1..108 100 -> Plus
arm_3L 13294918..13295022 109..213 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:46:16 Download gff for IP02110.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13294745..13294852 1..108 100 -> Plus
3L 13294918..13295022 109..213 100   Plus

IP02110.pep Sequence

Translation from 2 to 160

> IP02110.pep
LALFLVLVCVLGLVQAWEWPWNRKPTKFPIPSPNPRDKWCRLNLGPAWGG
RC*

IP02110.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:14:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15632-PA 56 GG15632-PA 4..56 1..52 216 77.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:02
Subject Length Description Subject Range Query Range Score Percent Strand
SP-PA 55 CG17673-PA 4..55 1..52 309 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:14:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Acp70A-PA 55 GM25408-PA 18..55 15..52 191 89.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:14:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Acp70A-PA 55 GD14439-PA 18..55 15..52 196 94.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:14:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21959-PA 55 GE21959-PA 4..55 1..52 214 75 Plus

IP02110.hyp Sequence

Translation from 2 to 160

> IP02110.hyp
LALFLVLVCVLGLVQAWEWPWNRKPTKFPIPSPNPRDKWCRLNLGPAWGG
RC*

IP02110.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
SP-PA 55 CG17673-PA 4..55 1..52 309 100 Plus