IP02110.complete Sequence
237 bp (237 high quality bases) assembled on 2005-03-04
GenBank Submission: BT023349
> IP02110.complete
CTCTAGCTCTATTCTTGGTTCTCGTTTGCGTACTCGGCTTGGTCCAGGCC
TGGGAATGGCCGTGGAATAGGAAGCCTACAAAGTTTCCAATTCCAAGCCC
CAATCCTCGTGATAAGTGGTGCCGTCTTAATTTGGGGCCCGCCTGGGGTG
GAAGATGTTAAGATATGAATATTTGAGCTTAATATAAAATAAACCCACCC
ACCAAAATGTCTTAAAAAAAAAAAAAAAAAAAAAAAA
IP02110.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:53:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp70A-RA | 307 | Acp70A-RA | 27..243 | 1..217 | 1085 | 100 | Plus |
Acp70A.a | 252 | Acp70A.a | 139..247 | 109..217 | 545 | 100 | Plus |
Acp70A.a | 252 | Acp70A.a | 11..118 | 1..108 | 540 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:32:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 13291893..13292002 | 1..110 | 550 | 100 | Plus |
chr3L | 24539361 | chr3L | 13292066..13292170 | 109..213 | 525 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:33:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:32:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 13301645..13301754 | 1..110 | 550 | 100 | Plus |
3L | 28110227 | 3L | 13301818..13301926 | 109..217 | 545 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:42:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 13294745..13294854 | 1..110 | 550 | 100 | Plus |
3L | 28103327 | 3L | 13294918..13295026 | 109..217 | 545 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 13:32:32 has no hits.
IP02110.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:33:19 Download gff for
IP02110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 13291893..13292000 | 1..108 | 100 | -> | Plus |
chr3L | 13292066..13292170 | 109..213 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:16:49 Download gff for
IP02110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp70A-RA | 8..168 | 1..161 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:25:45 Download gff for
IP02110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp70A-RA | 8..168 | 1..161 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:19:47 Download gff for
IP02110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp70A-RA | 8..168 | 1..161 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:09:52 Download gff for
IP02110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp70A-RA | 8..168 | 1..161 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:21:18 Download gff for
IP02110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
SP-RA | 8..168 | 1..161 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:28:17 Download gff for
IP02110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp70A-RA | 11..223 | 1..213 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:25:45 Download gff for
IP02110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp70A-RA | 11..223 | 1..213 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:19:47 Download gff for
IP02110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp70A-RA | 11..223 | 1..213 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:09:52 Download gff for
IP02110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp70A-RA | 11..223 | 1..213 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:21:18 Download gff for
IP02110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
SP-RA | 11..223 | 1..213 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:33:19 Download gff for
IP02110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13301645..13301752 | 1..108 | 100 | -> | Plus |
3L | 13301818..13301922 | 109..213 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:33:19 Download gff for
IP02110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13301645..13301752 | 1..108 | 100 | -> | Plus |
3L | 13301818..13301922 | 109..213 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:33:19 Download gff for
IP02110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13301645..13301752 | 1..108 | 100 | -> | Plus |
3L | 13301818..13301922 | 109..213 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:19:47 Download gff for
IP02110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 13294745..13294852 | 1..108 | 100 | -> | Plus |
arm_3L | 13294918..13295022 | 109..213 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:46:16 Download gff for
IP02110.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13294745..13294852 | 1..108 | 100 | -> | Plus |
3L | 13294918..13295022 | 109..213 | 100 | | Plus |
IP02110.pep Sequence
Translation from 2 to 160
> IP02110.pep
LALFLVLVCVLGLVQAWEWPWNRKPTKFPIPSPNPRDKWCRLNLGPAWGG
RC*
IP02110.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:14:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15632-PA | 56 | GG15632-PA | 4..56 | 1..52 | 216 | 77.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
SP-PA | 55 | CG17673-PA | 4..55 | 1..52 | 309 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:14:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\Acp70A-PA | 55 | GM25408-PA | 18..55 | 15..52 | 191 | 89.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:14:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\Acp70A-PA | 55 | GD14439-PA | 18..55 | 15..52 | 196 | 94.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:14:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21959-PA | 55 | GE21959-PA | 4..55 | 1..52 | 214 | 75 | Plus |
IP02110.hyp Sequence
Translation from 2 to 160
> IP02110.hyp
LALFLVLVCVLGLVQAWEWPWNRKPTKFPIPSPNPRDKWCRLNLGPAWGG
RC*
IP02110.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:44:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
SP-PA | 55 | CG17673-PA | 4..55 | 1..52 | 309 | 100 | Plus |