Clone IP02113 Report

Search the DGRC for IP02113

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:21
Well:13
Vector:pOT2
Associated Gene/TranscriptAcp29AB-RA
Protein status:IP02113.pep: gold
Preliminary Size:774
Sequenced Size:785

Clone Sequence Records

IP02113.complete Sequence

785 bp assembled on 2009-08-31

GenBank Submission: BT088801.1

> IP02113.complete
CCAAACTGGACATGTACGCATCTAACCTCTTATACCTGTTGGCATTATGG
AACCTTTGGGATCTCAGTGGTGGGCAGCAGGACATTCCGAACGGAAAGGC
TACATTGCCAAGTCCACAAACGCCGCAAAATACAATCGATCAGATTGGTA
TTAACCAGAATTATTGGTTTACATACAACGCGCTTAAACAAAACGAAACA
TTGGCAATTATTGATACAATGGAAATGCGCATAGCAAGTAGCTTGCTGGA
GTTTAAGGCCCAGATGGAAATCCAGCTTCAGCCGTTAAAGATTATAATGC
GACACCATGCATCCAACATCAAAGCGTCTAACAACATCAAGATGAGACGA
TTCGAGAAAGTTGGCTCCAGACATTTTCACATCGAGAAGAATCTAATGCA
AACTTGGTTTGAGGCATATGTCACATGTCGTAAAATGAACGGTCATCTGG
CGAACATCCAGGATGAGATGGAGCTGGATGGCATCTTGGCGTTAGCACCC
AACAATAGCTACTGGATAGATATATCCAAACTGGTTGAAAATGGCGGCAC
ATTCGTCTCCACCCTAACCGGACGAGAACCCTTCTTTGTCAAATGGAAGA
GTAATCAGGATACAAAAAAAAAGAATCAATGCGTTTACATCTATGCTAAA
GAGATGTCCTATGATGAGTGTTTTGAAAAAAAATCTTTCGTTTGCCAAGC
AGACCAGTGGGCCTAAACATAAAGAAAATATTGTTTTGTAGCTTGAATAA
AAAAAAACAGCTCGTTTAAAAAAAAAAAAAAAAAA

IP02113.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:31:45
Subject Length Description Subject Range Query Range Score Percent Strand
Acp29AB-RA 784 Acp29AB-RA 18..784 1..767 3835 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:55:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8391353..8392119 767..1 3775 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:33:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:55:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8392454..8393222 769..1 3845 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:48:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8392454..8393222 769..1 3845 100 Minus
Blast to na_te.dros performed on 2019-03-16 17:55:49 has no hits.

IP02113.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:56:58 Download gff for IP02113.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8391353..8392119 1..767 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:15:05 Download gff for IP02113.complete
Subject Subject Range Query Range Percent Splice Strand
Acp29AB-RA 1..705 12..716 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:47:33 Download gff for IP02113.complete
Subject Subject Range Query Range Percent Splice Strand
Acp29AB-RA 1..705 12..716 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:52 Download gff for IP02113.complete
Subject Subject Range Query Range Percent Splice Strand
Acp29AB-RA 1..705 12..716 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:23:05 Download gff for IP02113.complete
Subject Subject Range Query Range Percent Splice Strand
Acp29AB-RA 1..705 12..716 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-31 10:55:27 Download gff for IP02113.complete
Subject Subject Range Query Range Percent Splice Strand
Acp29AB-RA 18..765 1..748 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:47:33 Download gff for IP02113.complete
Subject Subject Range Query Range Percent Splice Strand
Acp29AB-RA 18..765 1..748 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:52 Download gff for IP02113.complete
Subject Subject Range Query Range Percent Splice Strand
Acp29AB-RA 1..767 1..767 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:23:05 Download gff for IP02113.complete
Subject Subject Range Query Range Percent Splice Strand
Acp29AB-RA 1..767 1..767 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:56:58 Download gff for IP02113.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8392456..8393222 1..767 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:56:58 Download gff for IP02113.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8392456..8393222 1..767 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:56:58 Download gff for IP02113.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8392456..8393222 1..767 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:52 Download gff for IP02113.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8392456..8393222 1..767 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:23:02 Download gff for IP02113.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8392456..8393222 1..767 100   Minus

IP02113.hyp Sequence

Translation from 2 to 715

> IP02113.hyp
KLDMYASNLLYLLALWNLWDLSGGQQDIPNGKATLPSPQTPQNTIDQIGI
NQNYWFTYNALKQNETLAIIDTMEMRIASSLLEFKAQMEIQLQPLKIIMR
HHASNIKASNNIKMRRFEKVGSRHFHIEKNLMQTWFEAYVTCRKMNGHLA
NIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKWKS
NQDTKKKNQCVYIYAKEMSYDECFEKKSFVCQADQWA*

IP02113.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
Acp29AB-PA 234 CG17797-PA 1..234 4..237 1248 100 Plus
lectin-29Ca-PA 236 CG17799-PA 4..236 5..237 557 45.1 Plus
lectin-30A-PA 223 CG17011-PA 29..222 45..236 386 39.8 Plus
CG2839-PA 826 CG2839-PA 53..266 45..235 270 30.7 Plus
lectin-21Cb-PB 249 CG13686-PB 68..248 48..233 246 31.4 Plus

IP02113.pep Sequence

Translation from 2 to 715

> IP02113.pep
KLDMYASNLLYLLALWNLWDLSGGQQDIPNGKATLPSPQTPQNTIDQIGI
NQNYWFTYNALKQNETLAIIDTMEMRIASSLLEFKAQMEIQLQPLKIIMR
HHASNIKASNNIKMRRFEKVGSRHFHIEKNLMQTWFEAYVTCRKMNGHLA
NIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKWKS
NQDTKKKNQCVYIYAKEMSYDECFEKKSFVCQADQWA*

IP02113.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19731-PA 235 GF19731-PA 61..232 61..232 240 34.1 Plus
Dana\GF15345-PA 204 GF15345-PA 77..200 113..234 207 36.3 Plus
Dana\GF14435-PA 432 GF14435-PA 280..426 89..234 204 30.5 Plus
Dana\GF14434-PA 168 GF14434-PA 40..160 117..233 196 35.2 Plus
Dana\GF15691-PA 176 GF15691-PA 53..172 117..233 196 35.5 Plus
Dana\GF14435-PA 432 GF14435-PA 99..210 99..210 153 31.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23444-PA 165 GG23444-PA 1..165 73..237 433 50.3 Plus
Dere\GG24034-PA 276 GG24034-PA 78..272 45..237 409 40.5 Plus
Dere\GG24734-PA 269 GG24734-PA 51..265 51..232 251 34.3 Plus
Dere\GG24634-PA 172 GG24634-PA 55..171 117..233 231 39 Plus
Dere\GG24559-PA 1288 GG24559-PA 87..258 62..235 220 35.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11271-PA 376 GH11271-PA 249..372 117..233 194 36.8 Plus
Dgri\GH23701-PA 385 GH23701-PA 258..381 117..233 193 36.8 Plus
Dgri\GH10464-PA 197 GH10464-PA 71..194 115..233 151 29.7 Plus
Dgri\GH24460-PA 195 GH24460-PA 48..182 110..233 149 30.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
Acp29AB-PA 234 CG17797-PA 1..234 4..237 1248 100 Plus
lectin-29Ca-PA 236 CG17799-PA 4..236 5..237 557 45.1 Plus
lectin-30A-PA 223 CG17011-PA 29..222 45..236 386 39.8 Plus
CG2839-PA 826 CG2839-PA 53..266 45..235 270 30.7 Plus
lectin-21Cb-PB 249 CG13686-PB 68..248 48..233 246 31.4 Plus
lectin-22C-PB 263 CG42295-PB 49..258 45..235 233 29.4 Plus
lectin-24Db-PA 359 CG2958-PA 176..357 67..235 221 29.5 Plus
lectin-21Ca-PA 269 CG2826-PA 51..265 51..232 218 30.4 Plus
lectin-28C-PC 265 CG7106-PC 97..263 69..235 210 31.8 Plus
lectin-28C-PB 265 CG7106-PB 97..263 69..235 210 31.8 Plus
lectin-24A-PA 282 CG3410-PA 113..279 70..232 199 28.6 Plus
CG15818-PA 283 CG15818-PA 71..280 30..234 191 25.8 Plus
CG15358-PE 252 CG15358-PE 49..247 45..234 183 30.2 Plus
CG15358-PD 252 CG15358-PD 49..247 45..234 183 30.2 Plus
CG7763-PD 232 CG7763-PD 109..227 117..232 176 34.7 Plus
CG7763-PC 232 CG7763-PC 109..227 117..232 176 34.7 Plus
lectin-37Db-PB 150 CG33533-PB 30..148 119..232 144 31.1 Plus
lectin-37Db-PA 150 CG33533-PA 30..148 119..232 144 31.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17697-PA 153 GI17697-PA 35..150 119..233 171 29.9 Plus
Dmoj\GI24628-PA 146 GI24628-PA 28..144 119..234 166 30.5 Plus
Dmoj\GI24639-PA 192 GI24639-PA 75..188 119..233 157 26.1 Plus
Dmoj\GI14022-PA 161 GI14022-PA 37..155 120..232 154 30 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26175-PA 238 GL26175-PA 99..223 117..233 191 34.1 Plus
Dper\GL19670-PA 282 GL19670-PA 106..275 77..233 181 29.7 Plus
Dper\GL10741-PA 236 GL10741-PA 52..232 45..233 177 30.1 Plus
Dper\GL26705-PA 277 GL26705-PA 84..276 45..232 166 24.5 Plus
Dper\GL26845-PA 183 GL26845-PA 54..177 117..233 158 32.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:55:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25561-PA 181 GA25561-PA 21..166 87..233 188 30.8 Plus
Dpse\GA24466-PA 236 GA24466-PA 52..232 45..233 176 30.1 Plus
Dpse\GA29024-PA 277 GA29024-PA 116..276 86..232 168 27.2 Plus
Dpse\GA29021-PA 141 GA29021-PA 9..131 117..233 158 30.6 Plus
Dpse\GA26690-PA 396 GA26690-PA 241..395 86..232 154 26.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:55:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Acp29AB-PA 234 GM12975-PA 1..234 4..237 1023 85 Plus
Dsec\GM12967-PA 235 GM12967-PA 4..235 5..237 518 43.3 Plus
Dsec\GM12506-PA 311 GM12506-PA 117..310 45..236 401 40.8 Plus
Dsec\GM16651-PA 249 GM16651-PA 132..248 117..233 232 39 Plus
Dsec\GM18119-PA 291 GM18119-PA 170..289 117..234 220 34.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:55:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Acp29AB-PA 234 GD22408-PA 18..234 21..237 1021 85.7 Plus
Dsim\lectin-29Ca-PA 235 GD22407-PA 4..235 5..237 515 42.5 Plus
Dsim\lectin-30A-PA 223 GD22361-PA 29..222 45..236 399 41.3 Plus
Dsim\GD23040-PA 783 GD23040-PA 53..266 45..235 242 29.3 Plus
Dsim\GD22945-PA 257 GD22945-PA 140..256 117..233 233 39 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:55:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16416-PA 164 GJ16416-PA 46..162 119..234 197 34.7 Plus
Dvir\GJ16497-PA 252 GJ16497-PA 87..248 70..233 190 31.6 Plus
Dvir\GJ11333-PA 226 GJ11333-PA 97..224 117..232 183 34.6 Plus
Dvir\GJ16447-PA 189 GJ16447-PA 63..186 114..233 174 31.2 Plus
Dvir\GJ18255-PA 159 GJ18255-PA 33..158 114..233 163 29.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:55:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19037-PA 249 GK19037-PA 88..241 88..234 220 35.5 Plus
Dwil\GK24541-PA 431 GK24541-PA 43..209 45..213 195 29.1 Plus
Dwil\GK19210-PA 164 GK19210-PA 37..162 113..233 194 33.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:55:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11017-PA 232 GE11017-PA 4..232 5..237 494 45.3 Plus
Dyak\GE10566-PA 234 GE10566-PA 1..234 4..237 394 33.5 Plus
Dyak\GE15974-PA 249 GE15974-PA 4..248 5..233 250 31 Plus
Dyak\GE16979-PA 269 GE16979-PA 113..265 86..232 240 39 Plus
Dyak\GE14533-PA 282 GE14533-PA 82..279 46..234 194 29.1 Plus