Clone IP02118 Report

Search the DGRC for IP02118

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:21
Well:18
Vector:pOT2
Associated Gene/Transcriptlectin-29Ca-RA
Protein status:IP02118.pep: gold
Preliminary Size:711
Sequenced Size:814

Clone Sequence Records

IP02118.complete Sequence

814 bp assembled on 2009-06-08

GenBank Submission: BT088774.1

> IP02118.complete
CGAGAGCCCTCGAAATGTACAAGTACGCAACTTGCATTTTCTCCATTTTC
GCTTTATGGAACTTTTGGGGCGTCAGTGCCAAAAAGCAGGATACTTCCAC
AGGAACAAATGAATTGCCAAAAGCACCAATGCCGTATTATACAATCGAGA
ATATTGATATGCACCAGCAGCACTGGTTTACCTACAATTCGCTAAGACAA
AATGGAACTTTGTGGAGAATTGGTAATATGGAGCAACGCTTAGAAATGCG
ATTGCAGTCCTTTCAAAACCAGATGGAAACTAAACTTCGGGCTCTAAAGC
AACAAATTGAACCCTACATGGAAAACGTTAAAATGTCCAACAAAATCAAA
ATGTCCGTATTCAAGAAGATTGGCTCCCGGCACTTTTACTTAGAAAAGCA
AAAGAAGATGCCCTGGGATAGCGCATACGACACGTGTCGTCAAATGGGCG
GTCACCTGGCGAATATCCTCGATGAGAAGGAGCTGAATGAAATATTCTCA
GAGGAAACCAAAAAAAAGTACTGGGTAGATATCAACAGCCGTGCCAACGA
TGGAGCGTCCTGGATTTCTACACTATCCGGAAGGGATGTACCATTTCTGA
AATGGAAGCCAAATCTGGCCACAAATATACATAACCATTGCGTGTATATC
AATTCCAATGAAATGTACTTTGAAAATTGTGCCAATGATAACTATTTTGC
TTGCCAAGCCGAGCAATGGGCCTGAATATCGAGCATTGATTTTTAGAACT
ATTTTAAACTTTAAATGTGACTTTGATAATAAAGGTTTAAAAATTGAAAA
AAAAAAAAAAAAAA

IP02118.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:31:25
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-29Ca-RA 792 lectin-29Ca-RA 1..792 5..796 3960 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:06:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8392388..8393179 796..5 3960 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:33:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:06:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8393487..8394280 798..5 3970 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8393487..8394280 798..5 3970 100 Minus
Blast to na_te.dros performed on 2019-03-16 01:06:54 has no hits.

IP02118.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:07:40 Download gff for IP02118.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8392388..8393184 1..796 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:04 Download gff for IP02118.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-29Ca-RA 1..711 15..725 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:47:02 Download gff for IP02118.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-29Ca-RA 1..711 15..725 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:53:44 Download gff for IP02118.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-29Ca-RA 1..711 15..725 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:23:45 Download gff for IP02118.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-29Ca-RA 1..711 15..725 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-08 14:10:02 Download gff for IP02118.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-29Ca-RA 1..711 15..725 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:47:02 Download gff for IP02118.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-29Ca-RA 1..792 5..796 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:53:44 Download gff for IP02118.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-29Ca-RA 1..792 5..796 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:23:45 Download gff for IP02118.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-29Ca-RA 1..792 5..796 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:07:40 Download gff for IP02118.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8393489..8394285 1..796 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:07:40 Download gff for IP02118.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8393489..8394285 1..796 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:07:40 Download gff for IP02118.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8393489..8394285 1..796 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:53:44 Download gff for IP02118.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8393489..8394285 1..796 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:22:27 Download gff for IP02118.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8393489..8394285 1..796 99   Minus

IP02118.hyp Sequence

Translation from 0 to 724

> IP02118.hyp
LLALEMYKYATCIFSIFALWNFWGVSAKKQDTSTGTNELPKAPMPYYTIE
NIDMHQQHWFTYNSLRQNGTLWRIGNMEQRLEMRLQSFQNQMETKLRALK
QQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMG
GHLANILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFL
KWKPNLATNIHNHCVYINSNEMYFENCANDNYFACQAEQWA*

IP02118.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-29Ca-PA 236 CG17799-PA 1..236 6..241 1296 100 Plus
Acp29AB-PA 234 CG17797-PA 2..234 9..241 557 45.1 Plus
lectin-30A-PA 223 CG17011-PA 1..222 6..240 396 35.4 Plus
lectin-21Ca-PA 269 CG2826-PA 1..265 6..236 256 27.9 Plus
lectin-28C-PC 265 CG7106-PC 101..263 81..239 231 34.1 Plus

IP02118.pep Sequence

Translation from 2 to 724

> IP02118.pep
RALEMYKYATCIFSIFALWNFWGVSAKKQDTSTGTNELPKAPMPYYTIEN
IDMHQQHWFTYNSLRQNGTLWRIGNMEQRLEMRLQSFQNQMETKLRALKQ
QIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGG
HLANILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLK
WKPNLATNIHNHCVYINSNEMYFENCANDNYFACQAEQWA*

IP02118.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15345-PA 204 GF15345-PA 51..200 89..237 235 37.9 Plus
Dana\GF15691-PA 176 GF15691-PA 26..172 89..236 213 33.6 Plus
Dana\GF15692-PA 176 GF15692-PA 22..171 97..235 207 31.8 Plus
Dana\GF19803-PA 189 GF19803-PA 19..184 69..235 187 30.2 Plus
Dana\GF14435-PA 432 GF14435-PA 259..425 67..236 182 26.3 Plus
Dana\GF14435-PA 432 GF14435-PA 46..201 51..204 158 29.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23444-PA 165 GG23444-PA 1..165 76..240 531 58.2 Plus
Dere\GG24034-PA 276 GG24034-PA 51..272 17..240 379 38.6 Plus
Dere\GG24734-PA 269 GG24734-PA 41..265 41..235 255 30.4 Plus
Dere\GG10503-PA 276 GG10503-PA 116..272 84..236 255 38.4 Plus
Dere\GG24634-PA 172 GG24634-PA 15..171 81..236 254 36.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10464-PA 197 GH10464-PA 2..194 48..236 207 30.8 Plus
Dgri\GH11271-PA 376 GH11271-PA 204..332 78..203 183 33.8 Plus
Dgri\GH23701-PA 385 GH23701-PA 213..341 78..203 183 33.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:41
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-29Ca-PA 236 CG17799-PA 1..236 5..240 1296 100 Plus
Acp29AB-PA 234 CG17797-PA 2..234 8..240 557 45.1 Plus
lectin-30A-PA 223 CG17011-PA 1..222 5..239 396 35.4 Plus
lectin-21Ca-PA 269 CG2826-PA 1..265 5..235 256 27.9 Plus
CG2839-PA 826 CG2839-PA 53..266 48..238 234 28.7 Plus
lectin-28C-PC 265 CG7106-PC 101..263 80..238 231 34.1 Plus
lectin-28C-PB 265 CG7106-PB 101..263 80..238 231 34.1 Plus
lectin-21Cb-PB 249 CG13686-PB 95..248 84..236 228 33.8 Plus
CG15358-PE 252 CG15358-PE 49..247 48..237 228 31.3 Plus
CG15358-PD 252 CG15358-PD 49..247 48..237 228 31.3 Plus
lectin-22C-PB 263 CG42295-PB 100..258 78..238 228 34.5 Plus
lectin-24Db-PA 359 CG2958-PA 189..357 69..238 218 32.9 Plus
CG15818-PA 283 CG15818-PA 85..280 47..237 217 28 Plus
CG7763-PD 232 CG7763-PD 40..227 67..235 195 25.3 Plus
CG7763-PC 232 CG7763-PC 40..227 67..235 195 25.3 Plus
lectin-24A-PA 282 CG3410-PA 126..279 79..235 195 29.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17697-PA 153 GI17697-PA 21..151 108..237 171 28.8 Plus
Dmoj\GI24628-PA 146 GI24628-PA 28..143 122..236 160 32.5 Plus
Dmoj\GI24639-PA 192 GI24639-PA 61..189 108..237 151 24.6 Plus
Dmoj\GI14022-PA 161 GI14022-PA 37..155 123..235 148 30.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:46:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26175-PA 238 GL26175-PA 45..223 78..236 209 31.1 Plus
Dper\GL10741-PA 236 GL10741-PA 22..232 24..236 209 30.2 Plus
Dper\GL19670-PA 282 GL19670-PA 93..275 56..236 187 25.4 Plus
Dper\GL26705-PA 277 GL26705-PA 122..258 87..228 175 31 Plus
Dper\GL26845-PA 183 GL26845-PA 54..177 120..236 171 35.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:46:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24466-PA 236 GA24466-PA 1..232 5..236 213 29.3 Plus
Dpse\GA25561-PA 181 GA25561-PA 10..166 90..236 209 32.9 Plus
Dpse\GA29024-PA 277 GA29024-PA 96..258 68..228 177 28.2 Plus
Dpse\GA22633-PA 411 GA22633-PA 293..395 120..220 169 37.1 Plus
Dpse\GA22633-PA 411 GA22633-PA 127..239 88..200 168 35.1 Plus
Dpse\GA29021-PA 141 GA29021-PA 5..131 116..236 153 29.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12967-PA 235 GM12967-PA 1..235 5..240 1085 81.8 Plus
Dsec\Acp29AB-PA 234 GM12975-PA 2..234 8..240 512 45.5 Plus
Dsec\GM12506-PA 311 GM12506-PA 117..310 48..239 382 38.6 Plus
Dsec\GM18119-PA 291 GM18119-PA 128..289 79..237 234 31.7 Plus
Dsec\GM16651-PA 249 GM16651-PA 132..248 120..236 229 40 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\lectin-29Ca-PA 235 GD22407-PA 1..235 5..240 1090 82.6 Plus
Dsim\Acp29AB-PA 234 GD22408-PA 18..234 24..240 515 46.1 Plus
Dsim\lectin-30A-PA 223 GD22361-PA 29..222 48..239 391 39.6 Plus
Dsim\GD23039-PA 269 GD23039-PA 1..265 5..235 262 28.6 Plus
Dsim\GD23494-PA 275 GD23494-PA 106..272 76..238 248 32.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16497-PA 252 GJ16497-PA 87..248 84..236 206 32.5 Plus
Dvir\GJ16447-PA 189 GJ16447-PA 4..186 70..236 205 28.8 Plus
Dvir\GJ11333-PA 226 GJ11333-PA 95..224 118..235 159 29.8 Plus
Dvir\GJ16416-PA 164 GJ16416-PA 46..161 122..236 158 30.8 Plus
Dvir\GJ18255-PA 159 GJ18255-PA 36..158 120..236 142 26.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24541-PA 431 GK24541-PA 43..209 48..216 222 33.1 Plus
Dwil\GK19037-PA 249 GK19037-PA 54..240 47..236 178 27.8 Plus
Dwil\GK19210-PA 164 GK19210-PA 1..162 80..236 172 29.3 Plus
Dwil\GK18670-PA 255 GK18670-PA 116..215 95..202 158 29.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11017-PA 232 GE11017-PA 1..232 5..240 685 54.9 Plus
Dyak\GE10566-PA 234 GE10566-PA 12..234 18..240 372 36.2 Plus
Dyak\GE16979-PA 269 GE16979-PA 70..265 70..235 234 31.5 Plus
Dyak\GE15974-PA 249 GE15974-PA 1..248 5..236 230 28.5 Plus
Dyak\GE15323-PA 368 GE15323-PA 162..363 41..237 215 30.3 Plus