Clone IP02161 Report

Search the DGRC for IP02161

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:21
Well:61
Vector:pOT2
Associated Gene/TranscriptMst84Dd-RA
Protein status:IP02161.pep: gold
Preliminary Size:427
Sequenced Size:424

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17935 2005-01-01 Successful iPCR screen
Mst84Dd 2008-04-29 Release 5.5 accounting
Mst84Dd 2008-08-15 Release 5.9 accounting
Mst84Dd 2008-12-18 5.12 accounting

Clone Sequence Records

IP02161.complete Sequence

424 bp (424 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023344

> IP02161.complete
GGCTTAACCCAAGAACATCAAAATTTGAGCTCTTTTCCAAGCTTTTTAGG
TTCAGCACTTTTTCTCAGAAATTAAAAAAAAACATGGGCTGTGCACCGGG
CGGACCTTGCTGCGGACCCTGTGGACCGTGTTGCGGACCCTGTTGTGGAC
CCTGTTGTGGACCCTGTTGTGGACCCTGTTGTGGACCTTGCGGGCCCTGC
TGTGGCCCCTGTGGACCTCGTTGTGGCCCTTGCGGACCCTGTGGACCGTG
CTGTGGCACTATGGAAAAACGAAATGGCCTTCAGCGGTGCTGTCCTTTTT
AGCTGTGATTTCCCGAATAAGCAACCAAACTGTGTCCAAAAAAAGATTTC
ATTAGTCTATTGTGACAAATAAAGGGGAACTATGAAAACTATCAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAA

IP02161.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
Mst84Dd-RA 558 Mst84Dd-RA 52..445 3..396 1970 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3189433..3189764 393..62 1660 100 Minus
chr3R 27901430 chr3R 3189817..3189875 61..3 295 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:33:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7363304..7363638 396..62 1675 100 Minus
3R 32079331 3R 7363691..7363749 61..3 295 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:43:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7104135..7104469 396..62 1675 100 Minus
3R 31820162 3R 7104522..7104580 61..3 295 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:49:58 has no hits.

IP02161.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:51:03 Download gff for IP02161.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3189433..3189638 188..393 100 == Minus
chr3R 3189707..3189764 62..119 100 <- Minus
chr3R 3189817..3189875 1..61 96   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:16:51 Download gff for IP02161.complete
Subject Subject Range Query Range Percent Splice Strand
Mst84Dd-RA 1..219 84..302 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:26:56 Download gff for IP02161.complete
Subject Subject Range Query Range Percent Splice Strand
Mst84Dd-RA 1..219 84..302 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:48:20 Download gff for IP02161.complete
Subject Subject Range Query Range Percent Splice Strand
Mst84Dd-RA 1..219 84..302 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:10:57 Download gff for IP02161.complete
Subject Subject Range Query Range Percent Splice Strand
Mst84Dd-RA 1..219 84..302 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:40:38 Download gff for IP02161.complete
Subject Subject Range Query Range Percent Splice Strand
Mst84Dd-RA 1..219 84..302 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:29:57 Download gff for IP02161.complete
Subject Subject Range Query Range Percent Splice Strand
Mst84Dd-RA 23..415 1..393 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:26:56 Download gff for IP02161.complete
Subject Subject Range Query Range Percent Splice Strand
Mst84Dd-RA 23..415 1..393 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:48:20 Download gff for IP02161.complete
Subject Subject Range Query Range Percent Splice Strand
Mst84Dd-RA 23..415 1..393 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:10:57 Download gff for IP02161.complete
Subject Subject Range Query Range Percent Splice Strand
Mst84Dd-RA 23..415 1..393 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:40:38 Download gff for IP02161.complete
Subject Subject Range Query Range Percent Splice Strand
Mst84Dd-RA 23..415 1..393 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:03 Download gff for IP02161.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7363307..7363638 62..393 100 <- Minus
3R 7363691..7363749 1..61 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:03 Download gff for IP02161.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7363307..7363638 62..393 100 <- Minus
3R 7363691..7363749 1..61 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:03 Download gff for IP02161.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7363307..7363638 62..393 100 <- Minus
3R 7363691..7363749 1..61 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:48:20 Download gff for IP02161.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3189029..3189360 62..393 100 <- Minus
arm_3R 3189413..3189471 1..61 96   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:47:30 Download gff for IP02161.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7104522..7104580 1..61 96   Minus
3R 7104138..7104469 62..393 100 <- Minus

IP02161.hyp Sequence

Translation from 2 to 301

> IP02161.hyp
LNPRTSKFELFSKLFRFSTFSQKLKKNMGCAPGGPCCGPCGPCCGPCCGP
CCGPCCGPCCGPCGPCCGPCGPRCGPCGPCGPCCGTMEKRNGLQRCCPF*

IP02161.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
Mst84Dd-PA 72 CG17935-PA 1..72 28..99 510 100 Plus
Mst84Db-PA 74 CG17934-PA 9..66 30..85 265 71.7 Plus
Mst84Dc-PB 55 CG17945-PB 2..51 36..85 259 80.8 Plus
Mst84Dc-PA 55 CG17945-PA 2..51 36..85 259 80.8 Plus
Mst84Db-PA 74 CG17934-PA 12..73 30..85 257 70.3 Plus
Mst87F-PB 56 CG17956-PB 2..52 36..85 257 79.2 Plus
Mst84Db-PA 74 CG17934-PA 2..65 36..97 224 61.2 Plus
Mst84Dc-PB 55 CG17945-PB 16..53 34..70 201 79.5 Plus
Mst84Dc-PA 55 CG17945-PA 16..53 34..70 201 79.5 Plus
Mst84Dc-PB 55 CG17945-PB 1..53 28..77 195 63.6 Plus
Mst84Dc-PA 55 CG17945-PA 1..53 28..77 195 63.6 Plus

IP02161.pep Sequence

Translation from 83 to 301

> IP02161.pep
MGCAPGGPCCGPCGPCCGPCCGPCCGPCCGPCCGPCGPCCGPCGPRCGPC
GPCGPCCGTMEKRNGLQRCCPF*

IP02161.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:37
Subject Length Description Subject Range Query Range Score Percent Strand
Mst84Dd-PA 72 CG17935-PA 1..72 1..72 510 100 Plus
Mst84Db-PA 74 CG17934-PA 9..66 3..58 265 71.7 Plus
Mst84Dc-PB 55 CG17945-PB 2..51 9..58 259 80.8 Plus
Mst84Dc-PA 55 CG17945-PA 2..51 9..58 259 80.8 Plus
Mst84Db-PA 74 CG17934-PA 12..73 3..58 257 70.3 Plus
Mst87F-PB 56 CG17956-PB 2..52 9..58 257 79.2 Plus
Mst87F-PA 56 CG17956-PA 2..52 9..58 257 79.2 Plus
Mst98Cb-PA 265 CG18396-PA 180..252 3..56 255 63.5 Plus
Pif2-PA 118 CG31483-PA 2..58 3..57 243 66.1 Plus
Pif2-PA 118 CG31483-PA 11..62 7..57 241 68.5 Plus
Pif2-PA 118 CG31483-PA 31..81 7..57 237 67.9 Plus
Pif2-PA 118 CG31483-PA 34..89 3..57 237 65.5 Plus
Mst98Ca-PA 334 CG11719-PA 180..290 3..56 233 45.5 Plus
Pif2-PA 118 CG31483-PA 14..77 3..57 232 60.9 Plus
Mst84Db-PA 74 CG17934-PA 2..65 9..70 224 61.2 Plus
Pif2-PA 118 CG31483-PA 64..115 8..59 224 64.8 Plus
Mst98Ca-PA 334 CG11719-PA 207..294 3..57 222 50.6 Plus
Mst84Da-PA 63 CG17946-PA 13..63 6..57 221 66.7 Plus
Mst84Da-PA 63 CG17946-PA 14..63 18..70 220 67.9 Plus
Pif2-PA 118 CG31483-PA 42..117 3..69 216 52.6 Plus
Mst98Cb-PA 265 CG18396-PA 213..265 2..56 212 72.9 Plus
Mst98Ca-PA 334 CG11719-PA 229..309 3..55 210 49.4 Plus
Mst84Dc-PB 55 CG17945-PB 16..53 7..43 201 79.5 Plus
Mst84Dc-PA 55 CG17945-PA 16..53 7..43 201 79.5 Plus
Mst98Ca-PA 334 CG11719-PA 236..334 3..56 200 47 Plus
Mst84Dc-PB 55 CG17945-PB 1..53 1..50 195 63.6 Plus
Mst84Dc-PA 55 CG17945-PA 1..53 1..50 195 63.6 Plus
CG9130-PB 517 CG9130-PB 239..290 8..58 179 57.6 Plus
CG9130-PA 517 CG9130-PA 239..290 8..58 179 57.6 Plus
CG30430-PB 51 CG30430-PB 4..51 7..57 169 58.5 Plus
CG30430-PA 51 CG30430-PA 4..51 7..57 169 58.5 Plus
Mst98Cb-PA 265 CG18396-PA 207..265 3..53 164 52.9 Plus
Mst84Da-PA 63 CG17946-PA 22..63 2..40 164 66.7 Plus
CG17377-PD 181 CG17377-PD 100..166 2..63 157 46.3 Plus
CG17377-PE 207 CG17377-PE 100..166 2..63 157 46.3 Plus
CG31740-PA 61 CG31740-PA 15..54 14..56 149 60 Plus
CG31639-PB 58 CG31639-PB 5..54 2..51 148 58.2 Plus
CG31639-PA 58 CG31639-PA 5..54 2..51 148 58.2 Plus
Mst87F-PB 56 CG17956-PB 2..39 32..71 147 63.4 Plus
Mst87F-PA 56 CG17956-PA 2..39 32..71 147 63.4 Plus
CG30430-PB 51 CG30430-PB 2..40 24..58 144 61.9 Plus
CG30430-PA 51 CG30430-PA 2..40 24..58 144 61.9 Plus
CG9130-PB 517 CG9130-PB 241..327 3..61 138 39.8 Plus
CG9130-PA 517 CG9130-PA 241..327 3..61 138 39.8 Plus
CG31740-PA 61 CG31740-PA 17..60 3..54 137 54.5 Plus
CG34167-PA 127 CG34167-PA 18..89 2..56 134 42.9 Plus
CG46059-PC 47 CG46059-PC 2..47 9..56 131 53.1 Plus
CG46059-PB 47 CG46059-PB 2..47 9..56 131 53.1 Plus
CG46059-PA 47 CG46059-PA 2..47 9..56 131 53.1 Plus
CG34167-PA 127 CG34167-PA 1..67 1..58 131 49.3 Plus