BDGP Sequence Production Resources |
Search the DGRC for IP02169
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 21 |
Well: | 69 |
Vector: | pOT2 |
Associated Gene/Transcript | Z600-RA |
Protein status: | IP02169.pep: gold |
Preliminary Size: | 273 |
Sequenced Size: | 438 |
Gene | Date | Evidence |
---|---|---|
CG17962 | 2005-01-01 | Successful iPCR screen |
Z600 | 2008-04-29 | Release 5.5 accounting |
Z600 | 2008-08-15 | Release 5.9 accounting |
Z600 | 2008-12-18 | 5.12 accounting |
438 bp assembled on 2006-11-09
GenBank Submission: BT023336
> IP02169.complete AACTTCCTGATCAGCCAGCCTAGCAGTTATTATGTCGTCGACAAATGAAA CCAACCAAGTGCTGCAGCGCCTGAACAGCCTGAAAATCGTGGAAACCCCA AAGGAGCAGCATGAGTTCGGAAAACGCGAGTGCTACTCCCTGGACAGCAA GAAGTATTCCCTGGTACCAGCCACCCCCAGCAGCTCAGGACACGGAAAGT TCCAAACCGAACTCAAAAAGCGCCGCAAAAACAAACTGAATCGCATGTAC ACTTACGAGGCTGATAAGAATTTCATCAAGGCTCGCAAATCTTTGAACTT CTAATCATAATACGAACCGATGTAATCACCTTAGTCATAAGCATCATTGA TTTCAAATCGTACAGTCACAATTCTTTTCACGCTCTGATACAACAAAAAT ATATATAAATACTTTTGAAACAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 15499045..15499465 | 1..421 | 2090 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 15509093..15509514 | 1..422 | 2110 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 15502193..15502614 | 1..422 | 2110 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
roo | 9092 | roo DM_ROO 9092bp | 1173..1225 | 368..420 | 103 | 66 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 15499045..15499465 | 1..421 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Z600-RA | 1..273 | 32..304 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Z600-RA | 1..273 | 32..304 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Z600-RA | 1..273 | 32..304 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Z600-RA | 1..273 | 32..304 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Z600-RA | 1..273 | 32..304 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Z600-RA | 33..453 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Z600-RA | 33..453 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Z600-RA | 33..453 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Z600-RA | 33..453 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Z600-RA | 33..453 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15509093..15509513 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15509093..15509513 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15509093..15509513 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 15502193..15502613 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15502193..15502613 | 1..421 | 100 | Plus |
Translation from 31 to 303
> IP02169.pep MSSTNETNQVLQRLNSLKIVETPKEQHEFGKRECYSLDSKKYSLVPATPS SSGHGKFQTELKKRRKNKLNRMYTYEADKNFIKARKSLNF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23702-PA | 91 | GF23702-PA | 2..91 | 3..90 | 363 | 80 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15901-PA | 90 | GG15901-PA | 1..90 | 1..90 | 436 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14542-PA | 80 | GH14542-PA | 1..80 | 11..90 | 209 | 57.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Z600-PA | 90 | CG17962-PA | 1..90 | 1..90 | 464 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13113-PA | 88 | GI13113-PA | 5..88 | 6..90 | 268 | 67.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24823-PA | 82 | GL24823-PA | 3..82 | 2..90 | 292 | 68.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14745-PA | 82 | GA14745-PA | 3..82 | 2..90 | 292 | 68.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25530-PA | 90 | GM25530-PA | 1..90 | 1..90 | 459 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14545-PA | 90 | GD14545-PA | 1..90 | 1..90 | 459 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13860-PA | 88 | GJ13860-PA | 5..88 | 6..90 | 282 | 74.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10594-PA | 90 | GK10594-PA | 1..90 | 1..90 | 314 | 69.2 | Plus |
Translation from 31 to 303
> IP02169.hyp MSSTNETNQVLQRLNSLKIVETPKEQHEFGKRECYSLDSKKYSLVPATPS SSGHGKFQTELKKRRKNKLNRMYTYEADKNFIKARKSLNF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Z600-PA | 90 | CG17962-PA | 1..90 | 1..90 | 464 | 100 | Plus |