Clone IP02169 Report

Search the DGRC for IP02169

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:21
Well:69
Vector:pOT2
Associated Gene/TranscriptZ600-RA
Protein status:IP02169.pep: gold
Preliminary Size:273
Sequenced Size:438

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17962 2005-01-01 Successful iPCR screen
Z600 2008-04-29 Release 5.5 accounting
Z600 2008-08-15 Release 5.9 accounting
Z600 2008-12-18 5.12 accounting

Clone Sequence Records

IP02169.complete Sequence

438 bp assembled on 2006-11-09

GenBank Submission: BT023336

> IP02169.complete
AACTTCCTGATCAGCCAGCCTAGCAGTTATTATGTCGTCGACAAATGAAA
CCAACCAAGTGCTGCAGCGCCTGAACAGCCTGAAAATCGTGGAAACCCCA
AAGGAGCAGCATGAGTTCGGAAAACGCGAGTGCTACTCCCTGGACAGCAA
GAAGTATTCCCTGGTACCAGCCACCCCCAGCAGCTCAGGACACGGAAAGT
TCCAAACCGAACTCAAAAAGCGCCGCAAAAACAAACTGAATCGCATGTAC
ACTTACGAGGCTGATAAGAATTTCATCAAGGCTCGCAAATCTTTGAACTT
CTAATCATAATACGAACCGATGTAATCACCTTAGTCATAAGCATCATTGA
TTTCAAATCGTACAGTCACAATTCTTTTCACGCTCTGATACAACAAAAAT
ATATATAAATACTTTTGAAACAAAAAAAAAAAAAAAAA

IP02169.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:12:39
Subject Length Description Subject Range Query Range Score Percent Strand
Z600-RA 453 Z600-RA 33..453 1..421 2105 100 Plus
gdl-RA 965 gdl-RA 1..70 353..422 350 100 Plus
gdl-ORF39-RA 965 gdl-ORF39-RA 1..70 353..422 350 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15499045..15499465 1..421 2090 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:33:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15509093..15509514 1..422 2110 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15502193..15502614 1..422 2110 100 Plus
Blast to na_te.dros performed 2019-03-16 15:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 1173..1225 368..420 103 66 Plus

IP02169.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:52:18 Download gff for IP02169.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15499045..15499465 1..421 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:16:55 Download gff for IP02169.complete
Subject Subject Range Query Range Percent Splice Strand
Z600-RA 1..273 32..304 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:20:07 Download gff for IP02169.complete
Subject Subject Range Query Range Percent Splice Strand
Z600-RA 1..273 32..304 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:20:12 Download gff for IP02169.complete
Subject Subject Range Query Range Percent Splice Strand
Z600-RA 1..273 32..304 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:36:59 Download gff for IP02169.complete
Subject Subject Range Query Range Percent Splice Strand
Z600-RA 1..273 32..304 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:49:27 Download gff for IP02169.complete
Subject Subject Range Query Range Percent Splice Strand
Z600-RA 1..273 32..304 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:48:25 Download gff for IP02169.complete
Subject Subject Range Query Range Percent Splice Strand
Z600-RA 33..453 1..421 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:20:07 Download gff for IP02169.complete
Subject Subject Range Query Range Percent Splice Strand
Z600-RA 33..453 1..421 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:20:12 Download gff for IP02169.complete
Subject Subject Range Query Range Percent Splice Strand
Z600-RA 33..453 1..421 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:37:00 Download gff for IP02169.complete
Subject Subject Range Query Range Percent Splice Strand
Z600-RA 33..453 1..421 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:49:27 Download gff for IP02169.complete
Subject Subject Range Query Range Percent Splice Strand
Z600-RA 33..453 1..421 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:52:18 Download gff for IP02169.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15509093..15509513 1..421 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:52:18 Download gff for IP02169.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15509093..15509513 1..421 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:52:18 Download gff for IP02169.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15509093..15509513 1..421 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:20:12 Download gff for IP02169.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15502193..15502613 1..421 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:49:14 Download gff for IP02169.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15502193..15502613 1..421 100   Plus

IP02169.pep Sequence

Translation from 31 to 303

> IP02169.pep
MSSTNETNQVLQRLNSLKIVETPKEQHEFGKRECYSLDSKKYSLVPATPS
SSGHGKFQTELKKRRKNKLNRMYTYEADKNFIKARKSLNF*

IP02169.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23702-PA 91 GF23702-PA 2..91 3..90 363 80 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15901-PA 90 GG15901-PA 1..90 1..90 436 94.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14542-PA 80 GH14542-PA 1..80 11..90 209 57.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
Z600-PA 90 CG17962-PA 1..90 1..90 464 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13113-PA 88 GI13113-PA 5..88 6..90 268 67.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:39:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24823-PA 82 GL24823-PA 3..82 2..90 292 68.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:39:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14745-PA 82 GA14745-PA 3..82 2..90 292 68.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:39:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25530-PA 90 GM25530-PA 1..90 1..90 459 97.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14545-PA 90 GD14545-PA 1..90 1..90 459 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13860-PA 88 GJ13860-PA 5..88 6..90 282 74.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:39:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10594-PA 90 GK10594-PA 1..90 1..90 314 69.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:39:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23146-PA 90 GE23146-PA 1..90 1..90 423 91.1 Plus
Dyak\GE22242-PA 90 GE22242-PA 1..90 1..90 423 91.1 Plus

IP02169.hyp Sequence

Translation from 31 to 303

> IP02169.hyp
MSSTNETNQVLQRLNSLKIVETPKEQHEFGKRECYSLDSKKYSLVPATPS
SSGHGKFQTELKKRRKNKLNRMYTYEADKNFIKARKSLNF*

IP02169.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:45:36
Subject Length Description Subject Range Query Range Score Percent Strand
Z600-PA 90 CG17962-PA 1..90 1..90 464 100 Plus