BDGP Sequence Production Resources |
Search the DGRC for IP02193
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 21 |
Well: | 93 |
Vector: | pOT2 |
Associated Gene/Transcript | GstD10-RA |
Protein status: | IP02193.pep: gold |
Preliminary Size: | 633 |
Sequenced Size: | 854 |
Gene | Date | Evidence |
---|---|---|
CG18548 | 2005-01-01 | Successful iPCR screen |
GstD10 | 2008-04-29 | Release 5.5 accounting |
GstD10 | 2008-08-15 | Release 5.9 accounting |
GstD10 | 2008-12-18 | 5.12 accounting |
854 bp (854 high quality bases) assembled on 2006-02-24
GenBank Submission: BT025011
> IP02193.complete CAGCCGAGTATATTTGATTACCACGTAGTTTCCAGAGATCCCTTCAGAAA GTGAGATAGCGTAAGATGGATTTATACTATAGACCCGGATCTGCTCCCTG CCGCTCTGTTCTGATGACAGCCAAGGCACTGGGTGTGGAGTTCGATAAGA AGACCATTATCAACACCCGAGCTAGGGAGCAATTCACGCCGGAATACCTG AAAATCAATCCGCAGCACACGATCCCCACGCTGCACGACCATGGATTTGC TTTGTGGGAGTCGCGGGCGATTATGGTTTATCTGGTGGAGAAGTACGGCA AGGACGACAAGCTCTTCCCCAAGGATGTGCAAAAGCAGGCGTTGATCAAT CAGCGCCTGTACTTCGACATGGGTACGCTGTATAAGAGCTTCTCCGAGTA CTATTATCCGCAGATTTTCCTAAAGAAGCCCGCCAATGAGGAGAACTACA AGAAGATCGAAGTGGCCTTCGAATTCCTAAACACATTCCTGGAGGGGCAG ACCTACAGCGCTGGAGGGGATTATAGCTTGGCGGATATTGCCTTTCTGGC CACCGTTTCCACTTTCGATGTGGCTGGCTTCGATTTCAAGCGGTATGCCA ATGTGGCACGTTGGTACGAGAATGCCAAGAAACTGACTCCCGGTTGGGAG GAAAACTGGGCTGGTTGCCAGGAGTTCCGCAAATACTTCGATAACTGAAT ATATGAACCCGAAATACTGATAAAACACCTATTATTCGGTTATCAAGAAA AAACTATATATTTAAAGATTAAGACTGGGCTGGATTTCGATAGACATTTC AATAGTTAAATAAAAAAAATTCACTTTTAAAGTTTAAAAAAAAAAAAAAA AAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
GstD10-RA | 1038 | GstD10-RA | 202..1038 | 1..837 | 4185 | 100 | Plus |
GstD1-RA | 828 | GstD1-RA | 345..502 | 343..500 | 340 | 81 | Plus |
GstD1.a | 840 | GstD1.a | 363..520 | 343..500 | 340 | 81 | Plus |
GstD1-RA | 828 | GstD1-RA | 190..304 | 188..302 | 245 | 80.8 | Plus |
GstD1.a | 840 | GstD1.a | 208..322 | 188..302 | 245 | 80.8 | Plus |
GstD1-RA | 828 | GstD1-RA | 595..693 | 593..691 | 225 | 81.8 | Plus |
GstD1.a | 840 | GstD1.a | 613..711 | 593..691 | 225 | 81.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 8190153..8190961 | 835..27 | 4000 | 99.6 | Minus |
chr3R | 27901430 | chr3R | 8193323..8193826 | 691..188 | 645 | 75.2 | Minus |
chr3R | 27901430 | chr3R | 8198604..8199061 | 204..661 | 400 | 73.5 | Plus |
chr3R | 27901430 | chr3R | 8201290..8201735 | 214..659 | 370 | 72.2 | Plus |
chr3R | 27901430 | chr3R | 8199654..8200129 | 184..659 | 355 | 71.6 | Plus |
chr3R | 27901430 | chr3R | 8197511..8197715 | 205..409 | 320 | 77.1 | Plus |
chr3R | 27901430 | chr3R | 8205886..8206009 | 537..660 | 245 | 79.8 | Plus |
chr3R | 27901430 | chr3R | 8202697..8202866 | 213..382 | 205 | 74.7 | Plus |
chr3R | 27901430 | chr3R | 8204081..8204253 | 213..382 | 200 | 75.7 | Plus |
chr3R | 27901430 | chr3R | 8205524..8205741 | 175..392 | 190 | 72.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 12364774..12365584 | 837..27 | 4055 | 100 | Minus |
3R | 32079331 | 3R | 12367946..12368449 | 691..188 | 645 | 75.2 | Minus |
3R | 32079331 | 3R | 12373217..12373674 | 204..661 | 400 | 73.5 | Plus |
3R | 32079331 | 3R | 12375900..12376354 | 205..659 | 385 | 72.3 | Plus |
3R | 32079331 | 3R | 12374268..12374743 | 184..659 | 355 | 71.6 | Plus |
3R | 32079331 | 3R | 12372134..12372338 | 205..409 | 320 | 77.1 | Plus |
3R | 32079331 | 3R | 12380504..12380627 | 537..660 | 245 | 79.8 | Plus |
3R | 32079331 | 3R | 12377316..12377485 | 213..382 | 205 | 74.7 | Plus |
3R | 32079331 | 3R | 12378699..12378871 | 213..382 | 200 | 75.7 | Plus |
3R | 32079331 | 3R | 12380142..12380359 | 175..392 | 190 | 72.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 12105605..12106415 | 837..27 | 4055 | 100 | Minus |
3R | 31820162 | 3R | 12114048..12114216 | 204..372 | 380 | 81.6 | Plus |
3R | 31820162 | 3R | 12116731..12116935 | 205..409 | 365 | 78.5 | Plus |
3R | 31820162 | 3R | 12108968..12109125 | 500..343 | 340 | 81 | Minus |
3R | 31820162 | 3R | 12115099..12115295 | 184..380 | 310 | 77.1 | Plus |
3R | 31820162 | 3R | 12109166..12109280 | 302..188 | 245 | 80.8 | Minus |
3R | 31820162 | 3R | 12121335..12121458 | 537..660 | 245 | 79.8 | Plus |
3R | 31820162 | 3R | 12108777..12108875 | 691..593 | 225 | 81.8 | Minus |
3R | 31820162 | 3R | 12112965..12113086 | 205..326 | 220 | 78.6 | Plus |
3R | 31820162 | 3R | 12114282..12114415 | 438..571 | 205 | 76.8 | Plus |
3R | 31820162 | 3R | 12118147..12118316 | 213..382 | 205 | 74.7 | Plus |
3R | 31820162 | 3R | 12119530..12119618 | 213..301 | 190 | 80.8 | Plus |
3R | 31820162 | 3R | 12115508..12115574 | 593..659 | 170 | 83.5 | Plus |
3R | 31820162 | 3R | 12113103..12113169 | 343..409 | 155 | 82 | Plus |
3R | 31820162 | 3R | 12107128..12107176 | 660..612 | 155 | 87.7 | Minus |
3R | 31820162 | 3R | 12118481..12118595 | 547..661 | 140 | 74.7 | Plus |
3R | 31820162 | 3R | 12113372..12113420 | 612..660 | 140 | 85.7 | Plus |
3R | 31820162 | 3R | 12106522..12106549 | 28..1 | 140 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 8190153..8190959 | 29..835 | 99 | <- | Minus |
chr3R | 8191068..8191095 | 1..28 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GstD10-RA | 1..633 | 66..698 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GstD10-RA | 1..633 | 66..698 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GstD10-RA | 1..633 | 66..698 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GstD10-RA | 1..633 | 66..698 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GstD10-RA | 1..633 | 66..698 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GstD10-RA | 1..835 | 1..835 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GstD10-RA | 1..835 | 1..835 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GstD10-RA | 1..835 | 1..835 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GstD10-RA | 1..835 | 1..835 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GstD10-RA | 18..852 | 1..835 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12364776..12365582 | 29..835 | 100 | <- | Minus |
3R | 12365691..12365718 | 1..28 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12364776..12365582 | 29..835 | 100 | <- | Minus |
3R | 12365691..12365718 | 1..28 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12364776..12365582 | 29..835 | 100 | <- | Minus |
3R | 12365691..12365718 | 1..28 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 8190498..8191304 | 29..835 | 100 | <- | Minus |
arm_3R | 8191413..8191440 | 1..28 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12105607..12106413 | 29..835 | 100 | <- | Minus |
3R | 12106522..12106549 | 1..28 | 100 | Minus |
Translation from 65 to 697
> IP02193.hyp MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQ HTIPTLHDHGFALWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYF DMGTLYKSFSEYYYPQIFLKKPANEENYKKIEVAFEFLNTFLEGQTYSAG GDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENAKKLTPGWEENWAG CQEFRKYFDN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
GstD10-PB | 210 | CG18548-PB | 1..210 | 1..210 | 1129 | 100 | Plus |
GstD10-PA | 210 | CG18548-PA | 1..210 | 1..210 | 1129 | 100 | Plus |
GstD1-PB | 209 | CG10045-PB | 2..209 | 1..209 | 817 | 71.3 | Plus |
GstD1-PA | 209 | CG10045-PA | 2..209 | 1..209 | 817 | 71.3 | Plus |
GstD5-PA | 216 | CG12242-PA | 1..208 | 1..209 | 731 | 63.2 | Plus |
Translation from 65 to 697
> IP02193.pep MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQ HTIPTLHDHGFALWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYF DMGTLYKSFSEYYYPQIFLKKPANEENYKKIEVAFEFLNTFLEGQTYSAG GDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENAKKLTPGWEENWAG CQEFRKYFDN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17054-PA | 210 | GF17054-PA | 1..210 | 1..210 | 979 | 84.8 | Plus |
Dana\GF17052-PA | 209 | GF17052-PA | 2..209 | 1..209 | 822 | 70.8 | Plus |
Dana\GF17943-PA | 218 | GF17943-PA | 1..206 | 1..206 | 751 | 67.1 | Plus |
Dana\GF17947-PA | 214 | GF17947-PA | 1..208 | 1..209 | 667 | 57.9 | Plus |
Dana\GF17944-PA | 219 | GF17944-PA | 1..210 | 1..209 | 653 | 57.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17138-PA | 210 | GG17138-PA | 1..210 | 1..210 | 1063 | 95.2 | Plus |
Dere\GG17139-PA | 210 | GG17139-PA | 1..210 | 1..210 | 1038 | 91.4 | Plus |
Dere\GstD1-PA | 209 | GG17135-PA | 3..209 | 2..209 | 821 | 70.7 | Plus |
Dere\GG18761-PA | 215 | GG18761-PA | 1..208 | 1..209 | 768 | 66.5 | Plus |
Dere\GG18783-PA | 216 | GG18783-PA | 1..208 | 1..209 | 724 | 61.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20197-PA | 210 | GH20197-PA | 1..210 | 1..210 | 891 | 75.2 | Plus |
Dgri\GH13113-PA | 210 | GH13113-PA | 1..210 | 1..210 | 891 | 75.2 | Plus |
Dgri\GH20186-PA | 209 | GH20186-PA | 3..209 | 2..209 | 811 | 69.7 | Plus |
Dgri\GH13103-PA | 209 | GH13103-PA | 3..209 | 2..209 | 807 | 69.2 | Plus |
Dgri\GH20559-PA | 216 | GH20559-PA | 1..209 | 1..210 | 760 | 65.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
GstD10-PB | 210 | CG18548-PB | 1..210 | 1..210 | 1129 | 100 | Plus |
GstD10-PA | 210 | CG18548-PA | 1..210 | 1..210 | 1129 | 100 | Plus |
GstD1-PB | 209 | CG10045-PB | 2..209 | 1..209 | 817 | 71.3 | Plus |
GstD1-PA | 209 | CG10045-PA | 2..209 | 1..209 | 817 | 71.3 | Plus |
GstD5-PA | 216 | CG12242-PA | 1..208 | 1..209 | 731 | 63.2 | Plus |
GstD2-PA | 215 | CG4181-PA | 1..208 | 1..209 | 726 | 62.7 | Plus |
GstD4-PA | 215 | CG11512-PA | 1..208 | 1..209 | 698 | 62.2 | Plus |
GstD9-PB | 218 | CG10091-PB | 2..210 | 1..208 | 676 | 58.6 | Plus |
GstD9-PA | 218 | CG10091-PA | 2..210 | 1..208 | 676 | 58.6 | Plus |
GstD8-PA | 212 | CG4421-PA | 1..205 | 1..206 | 672 | 61.2 | Plus |
GstD3-PA | 199 | CG4381-PA | 1..189 | 17..206 | 665 | 63.2 | Plus |
GstD6-PA | 215 | CG4423-PA | 1..206 | 1..207 | 637 | 58 | Plus |
GstD7-PA | 224 | CG4371-PA | 4..213 | 1..210 | 565 | 52.6 | Plus |
GstD11-PA | 222 | CG17639-PA | 6..190 | 3..188 | 463 | 44.1 | Plus |
GstD11-PB | 243 | CG17639-PB | 27..211 | 3..188 | 463 | 44.1 | Plus |
GstE7-PA | 223 | CG17531-PA | 6..212 | 3..207 | 380 | 38.5 | Plus |
GstE3-PA | 220 | CG17524-PA | 4..199 | 1..196 | 348 | 39.4 | Plus |
GstE8-PB | 222 | CG17533-PB | 6..200 | 3..196 | 336 | 35.5 | Plus |
GstE8-PA | 222 | CG17533-PA | 6..200 | 3..196 | 336 | 35.5 | Plus |
GstE6-PA | 222 | CG17530-PA | 4..213 | 1..208 | 335 | 35.2 | Plus |
GstE1-PA | 224 | CG5164-PA | 9..210 | 5..204 | 325 | 37.4 | Plus |
GstE12-PC | 223 | CG16936-PC | 6..213 | 3..208 | 324 | 37.3 | Plus |
GstE12-PB | 223 | CG16936-PB | 6..213 | 3..208 | 324 | 37.3 | Plus |
GstE12-PD | 223 | CG16936-PD | 6..213 | 3..208 | 324 | 37.3 | Plus |
GstE12-PA | 223 | CG16936-PA | 6..213 | 3..208 | 324 | 37.3 | Plus |
gfzf-PD | 234 | CG33546-PD | 1..212 | 1..210 | 322 | 37.2 | Plus |
gfzf-PE | 1045 | CG33546-PE | 812..1023 | 1..210 | 322 | 37.2 | Plus |
gfzf-PB | 1045 | CG33546-PB | 812..1023 | 1..210 | 322 | 37.2 | Plus |
GstE4-PA | 222 | CG17525-PA | 4..209 | 1..204 | 321 | 33.8 | Plus |
GstE5-PA | 222 | CG17527-PA | 4..208 | 1..203 | 308 | 33 | Plus |
GstE2-PA | 221 | CG17523-PA | 7..209 | 3..204 | 304 | 34.6 | Plus |
GstE11-PB | 225 | CG5224-PB | 7..203 | 3..197 | 304 | 35.8 | Plus |
GstE11-PA | 225 | CG5224-PA | 7..203 | 3..197 | 304 | 35.8 | Plus |
GstE9-PA | 221 | CG17534-PA | 6..190 | 3..185 | 298 | 36 | Plus |
GstE10-PB | 240 | CG17522-PB | 6..208 | 3..202 | 295 | 33.7 | Plus |
GstE10-PA | 240 | CG17522-PA | 6..208 | 3..202 | 295 | 33.7 | Plus |
GstE13-PB | 226 | CG11784-PB | 6..201 | 3..196 | 248 | 29.4 | Plus |
GstE13-PA | 226 | CG11784-PA | 6..201 | 3..196 | 248 | 29.4 | Plus |
GstE14-PA | 232 | CG4688-PA | 8..214 | 3..210 | 240 | 27.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24379-PA | 209 | GI24379-PA | 2..209 | 1..209 | 836 | 72.2 | Plus |
Dmoj\GI22354-PA | 208 | GI22354-PA | 1..208 | 1..209 | 834 | 72.7 | Plus |
Dmoj\GI22356-PA | 210 | GI22356-PA | 1..208 | 1..208 | 812 | 70.2 | Plus |
Dmoj\GI23195-PA | 216 | GI23195-PA | 1..208 | 1..209 | 721 | 61.7 | Plus |
Dmoj\GI23194-PA | 213 | GI23194-PA | 1..205 | 1..206 | 713 | 61.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL27186-PA | 209 | GL27186-PA | 1..209 | 1..210 | 944 | 83.3 | Plus |
Dper\GL27184-PA | 209 | GL27184-PA | 3..209 | 2..209 | 826 | 72.1 | Plus |
Dper\GL27300-PA | 217 | GL27300-PA | 1..209 | 1..210 | 766 | 64.3 | Plus |
Dper\GL27302-PA | 215 | GL27302-PA | 1..208 | 1..209 | 681 | 60.3 | Plus |
Dper\GL27303-PA | 213 | GL27303-PA | 1..210 | 1..210 | 675 | 58.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14986-PA | 209 | GA14986-PA | 1..209 | 1..210 | 938 | 82.4 | Plus |
Dpse\GA10031-PA | 209 | GA10031-PA | 3..209 | 2..209 | 826 | 72.1 | Plus |
Dpse\GA18009-PA | 219 | GA18009-PA | 1..209 | 1..210 | 767 | 64.3 | Plus |
Dpse\GA27028-PA | 215 | GA27028-PA | 1..208 | 1..209 | 677 | 59.8 | Plus |
Dpse\GA18171-PA | 213 | GA18171-PA | 1..210 | 1..210 | 676 | 58.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26022-PA | 210 | GM26022-PA | 1..210 | 1..210 | 1096 | 96.7 | Plus |
Dsec\GstD1-PA | 209 | GM26019-PA | 3..209 | 2..209 | 821 | 71.2 | Plus |
Dsec\GM24017-PA | 215 | GM24017-PA | 1..205 | 1..206 | 724 | 63.6 | Plus |
Dsec\GM24021-PA | 212 | GM24021-PA | 1..205 | 1..206 | 697 | 61.7 | Plus |
Dsec\GM24018-PA | 215 | GM24018-PA | 1..208 | 1..209 | 691 | 60.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20579-PA | 210 | GD20579-PA | 1..210 | 1..210 | 1103 | 97.6 | Plus |
Dsim\GstD1-PA | 209 | GD20577-PA | 3..209 | 2..209 | 820 | 71.2 | Plus |
Dsim\GD18816-PA | 215 | GD18816-PA | 1..205 | 1..206 | 727 | 63.6 | Plus |
Dsim\GD18815-PA | 215 | GD18815-PA | 1..208 | 1..209 | 726 | 62.2 | Plus |
Dsim\GD18818-PA | 216 | GD18818-PA | 1..208 | 1..209 | 710 | 61.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24385-PA | 209 | GJ24385-PA | 3..209 | 2..209 | 821 | 70.7 | Plus |
Dvir\GJ22854-PA | 213 | GJ22854-PA | 1..205 | 1..206 | 727 | 62.6 | Plus |
Dvir\GJ14446-PA | 213 | GJ14446-PA | 1..204 | 1..205 | 707 | 62.4 | Plus |
Dvir\GJ22852-PA | 214 | GJ22852-PA | 1..205 | 1..209 | 691 | 59.3 | Plus |
Dvir\GJ22855-PA | 200 | GJ22855-PA | 1..192 | 17..209 | 668 | 62.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11206-PA | 210 | GK11206-PA | 1..210 | 1..210 | 863 | 73.8 | Plus |
Dwil\GK11204-PA | 209 | GK11204-PA | 3..209 | 2..209 | 819 | 71.2 | Plus |
Dwil\GK11874-PA | 219 | GK11874-PA | 1..208 | 1..209 | 759 | 64.6 | Plus |
Dwil\GK11202-PA | 218 | GK11202-PA | 4..211 | 1..209 | 752 | 65.1 | Plus |
Dwil\GK11875-PA | 214 | GK11875-PA | 1..208 | 1..209 | 720 | 63.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24529-PA | 210 | GE24529-PA | 1..210 | 1..210 | 1074 | 95.2 | Plus |
Dyak\GstD1-PA | 209 | GE24527-PA | 3..209 | 2..209 | 821 | 71.2 | Plus |
Dyak\GE26175-PA | 215 | GE26175-PA | 1..208 | 1..209 | 764 | 65.6 | Plus |
Dyak\GE26178-PA | 216 | GE26178-PA | 1..208 | 1..209 | 732 | 62.7 | Plus |
Dyak\GE26176-PA | 215 | GE26176-PA | 1..205 | 1..206 | 725 | 63.6 | Plus |