Clone IP02222 Report

Search the DGRC for IP02222

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:22
Well:22
Vector:pOT2
Associated Gene/TranscriptPebII-RA
Protein status:IP02222.pep: gold
Preliminary Size:336
Sequenced Size:381

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2665 2005-01-01 Successful iPCR screen
PebII 2008-04-29 Release 5.5 accounting
PebII 2008-08-15 Release 5.9 accounting
PebII 2008-12-18 5.12 accounting

Clone Sequence Records

IP02222.complete Sequence

381 bp (381 high quality bases) assembled on 2005-03-04

GenBank Submission: BT023332

> IP02222.complete
AGACACTTGAGTTCAGTTTACAGCATGATTCGAATTTTGGTTTTAATGAT
TACATTCACTCTAATGACTGGTAGCGCTCTTTGTTCTATCGAGCAACTTA
TGCGGGTCTTTGGCGGTGGATCTGTTGGAGGAGGTTCTAGGCTGGACATC
AACAGAAGGGTAACTATAGTACCACCCGAAGGCGAACTCTCGTTTGGATA
TGGCTTTCGTCCTGGATTCTATTGATTTAATCCGCATCTATATTATTTGT
TTTGTGTTGAGGGCAGCTGGTTTCATGTACAGCGTAAACGCTTTATAATA
TTTAAATATACTATTTACTCAATGCTACTACAAATACAATCAATGTTGTC
ACATTAAAAAAAAAAAAAAAAAAAAAAAAAA

IP02222.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:57
Subject Length Description Subject Range Query Range Score Percent Strand
PebII-RA 522 PebII-RA 48..404 1..357 1785 100 Plus
PebII.a 690 PebII.a 16..372 1..357 1785 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:39:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 21059706..21060019 355..39 1505 99.1 Minus
chr2R 21145070 chr2R 21060073..21060113 41..1 205 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:33:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 25173795..25174113 357..39 1595 100 Minus
2R 25286936 2R 25174166..25174206 41..1 205 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:06:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 25174994..25175312 357..39 1595 100 Minus
2R 25260384 2R 25175365..25175405 41..1 205 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:39:06 has no hits.

IP02222.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:40:02 Download gff for IP02222.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 21059706..21060018 40..355 99 <- Minus
chr2R 21060075..21060113 1..39 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:17:04 Download gff for IP02222.complete
Subject Subject Range Query Range Percent Splice Strand
PebII-RA 1..201 25..225 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:40:08 Download gff for IP02222.complete
Subject Subject Range Query Range Percent Splice Strand
PebII-RA 1..201 25..225 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:31:51 Download gff for IP02222.complete
Subject Subject Range Query Range Percent Splice Strand
PebII-RA 1..201 25..225 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:17:31 Download gff for IP02222.complete
Subject Subject Range Query Range Percent Splice Strand
PebII-RA 1..201 25..225 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:30:20 Download gff for IP02222.complete
Subject Subject Range Query Range Percent Splice Strand
PebII-RA 1..201 25..225 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:45:29 Download gff for IP02222.complete
Subject Subject Range Query Range Percent Splice Strand
PebII-RA 1..355 1..355 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:40:08 Download gff for IP02222.complete
Subject Subject Range Query Range Percent Splice Strand
PebII-RA 1..355 1..355 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:31:51 Download gff for IP02222.complete
Subject Subject Range Query Range Percent Splice Strand
PebII-RA 1..355 1..355 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:17:31 Download gff for IP02222.complete
Subject Subject Range Query Range Percent Splice Strand
PebII-RA 1..336 19..354 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:30:20 Download gff for IP02222.complete
Subject Subject Range Query Range Percent Splice Strand
PebII-RA 25..379 1..355 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:40:02 Download gff for IP02222.complete
Subject Subject Range Query Range Percent Splice Strand
2R 25173797..25174112 40..355 100 <- Minus
2R 25174168..25174206 1..39 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:40:02 Download gff for IP02222.complete
Subject Subject Range Query Range Percent Splice Strand
2R 25173797..25174112 40..355 100 <- Minus
2R 25174168..25174206 1..39 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:40:02 Download gff for IP02222.complete
Subject Subject Range Query Range Percent Splice Strand
2R 25173797..25174112 40..355 100 <- Minus
2R 25174168..25174206 1..39 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:31:51 Download gff for IP02222.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 21061320..21061635 40..355 100 <- Minus
arm_2R 21061691..21061729 1..39 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:53:07 Download gff for IP02222.complete
Subject Subject Range Query Range Percent Splice Strand
2R 25175014..25175329 40..355 100 <- Minus
2R 25175385..25175423 1..39 100   Minus

IP02222.hyp Sequence

Translation from 0 to 224

> IP02222.hyp
RHLSSVYSMIRILVLMITFTLMTGSALCSIEQLMRVFGGGSVGGGSRLDI
NRRVTIVPPEGELSFGYGFRPGFY*

IP02222.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
PebII-PB 66 CG2665-PB 1..66 9..74 338 100 Plus
PebII-PA 66 CG2665-PA 1..66 9..74 338 100 Plus

IP02222.pep Sequence

Translation from 24 to 224

> IP02222.pep
MIRILVLMITFTLMTGSALCSIEQLMRVFGGGSVGGGSRLDINRRVTIVP
PEGELSFGYGFRPGFY*

IP02222.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:13:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19858-PA 65 GG19858-PA 1..65 1..66 236 81.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:44
Subject Length Description Subject Range Query Range Score Percent Strand
EbpII-PB 66 CG2665-PB 1..66 1..66 338 100 Plus
EbpII-PA 66 CG2665-PA 1..66 1..66 338 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:13:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11762-PA 66 GM11762-PA 1..66 1..66 266 95.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:13:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24895-PA 66 GD24895-PA 1..66 1..66 319 97 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:13:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11382-PA 68 GE11382-PA 1..68 1..66 190 68.1 Plus