IP02222.complete Sequence
381 bp (381 high quality bases) assembled on 2005-03-04
GenBank Submission: BT023332
> IP02222.complete
AGACACTTGAGTTCAGTTTACAGCATGATTCGAATTTTGGTTTTAATGAT
TACATTCACTCTAATGACTGGTAGCGCTCTTTGTTCTATCGAGCAACTTA
TGCGGGTCTTTGGCGGTGGATCTGTTGGAGGAGGTTCTAGGCTGGACATC
AACAGAAGGGTAACTATAGTACCACCCGAAGGCGAACTCTCGTTTGGATA
TGGCTTTCGTCCTGGATTCTATTGATTTAATCCGCATCTATATTATTTGT
TTTGTGTTGAGGGCAGCTGGTTTCATGTACAGCGTAAACGCTTTATAATA
TTTAAATATACTATTTACTCAATGCTACTACAAATACAATCAATGTTGTC
ACATTAAAAAAAAAAAAAAAAAAAAAAAAAA
IP02222.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:45:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
PebII-RA | 522 | PebII-RA | 48..404 | 1..357 | 1785 | 100 | Plus |
PebII.a | 690 | PebII.a | 16..372 | 1..357 | 1785 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:39:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 21059706..21060019 | 355..39 | 1505 | 99.1 | Minus |
chr2R | 21145070 | chr2R | 21060073..21060113 | 41..1 | 205 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:33:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:39:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 25173795..25174113 | 357..39 | 1595 | 100 | Minus |
2R | 25286936 | 2R | 25174166..25174206 | 41..1 | 205 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:06:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 25174994..25175312 | 357..39 | 1595 | 100 | Minus |
2R | 25260384 | 2R | 25175365..25175405 | 41..1 | 205 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 14:39:06 has no hits.
IP02222.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:40:02 Download gff for
IP02222.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 21059706..21060018 | 40..355 | 99 | <- | Minus |
chr2R | 21060075..21060113 | 1..39 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:17:04 Download gff for
IP02222.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
PebII-RA | 1..201 | 25..225 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:40:08 Download gff for
IP02222.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
PebII-RA | 1..201 | 25..225 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:31:51 Download gff for
IP02222.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
PebII-RA | 1..201 | 25..225 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:17:31 Download gff for
IP02222.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
PebII-RA | 1..201 | 25..225 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:30:20 Download gff for
IP02222.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
PebII-RA | 1..201 | 25..225 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:45:29 Download gff for
IP02222.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
PebII-RA | 1..355 | 1..355 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:40:08 Download gff for
IP02222.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
PebII-RA | 1..355 | 1..355 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:31:51 Download gff for
IP02222.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
PebII-RA | 1..355 | 1..355 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:17:31 Download gff for
IP02222.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
PebII-RA | 1..336 | 19..354 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:30:20 Download gff for
IP02222.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
PebII-RA | 25..379 | 1..355 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:40:02 Download gff for
IP02222.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 25173797..25174112 | 40..355 | 100 | <- | Minus |
2R | 25174168..25174206 | 1..39 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:40:02 Download gff for
IP02222.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 25173797..25174112 | 40..355 | 100 | <- | Minus |
2R | 25174168..25174206 | 1..39 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:40:02 Download gff for
IP02222.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 25173797..25174112 | 40..355 | 100 | <- | Minus |
2R | 25174168..25174206 | 1..39 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:31:51 Download gff for
IP02222.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 21061320..21061635 | 40..355 | 100 | <- | Minus |
arm_2R | 21061691..21061729 | 1..39 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:53:07 Download gff for
IP02222.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 25175014..25175329 | 40..355 | 100 | <- | Minus |
2R | 25175385..25175423 | 1..39 | 100 | | Minus |
IP02222.hyp Sequence
Translation from 0 to 224
> IP02222.hyp
RHLSSVYSMIRILVLMITFTLMTGSALCSIEQLMRVFGGGSVGGGSRLDI
NRRVTIVPPEGELSFGYGFRPGFY*
IP02222.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:46:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
PebII-PB | 66 | CG2665-PB | 1..66 | 9..74 | 338 | 100 | Plus |
PebII-PA | 66 | CG2665-PA | 1..66 | 9..74 | 338 | 100 | Plus |
IP02222.pep Sequence
Translation from 24 to 224
> IP02222.pep
MIRILVLMITFTLMTGSALCSIEQLMRVFGGGSVGGGSRLDINRRVTIVP
PEGELSFGYGFRPGFY*
IP02222.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:13:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG19858-PA | 65 | GG19858-PA | 1..65 | 1..66 | 236 | 81.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
EbpII-PB | 66 | CG2665-PB | 1..66 | 1..66 | 338 | 100 | Plus |
EbpII-PA | 66 | CG2665-PA | 1..66 | 1..66 | 338 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:13:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM11762-PA | 66 | GM11762-PA | 1..66 | 1..66 | 266 | 95.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:13:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD24895-PA | 66 | GD24895-PA | 1..66 | 1..66 | 319 | 97 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:13:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE11382-PA | 68 | GE11382-PA | 1..68 | 1..66 | 190 | 68.1 | Plus |