Clone IP02234 Report

Search the DGRC for IP02234

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:22
Well:34
Vector:pOT2
Associated Gene/TranscriptObp50c-RC
Protein status:IP02234.pep: gold
Preliminary Size:558
Sequenced Size:1259

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30072 2005-01-01 Successful iPCR screen
Obp50c 2008-04-29 Release 5.5 accounting
Obp50c 2008-08-15 Release 5.9 accounting
Obp50c 2008-12-18 5.12 accounting

Clone Sequence Records

IP02234.complete Sequence

1259 bp (1259 high quality bases) assembled on 2005-03-04

GenBank Submission: BT023328

> IP02234.complete
ACTTGCGAAGCTCTGGGCTCCAGACACGCCGACTTTCTGCTGCTCTACTC
CAACCAGGTGGCGGATAAGATGGGCATGGCTTCCTCAACCTGTCTGCCAT
ATGCCATGCTTCATGCACAGTGTACCATGGTATACCTAACCGCCAACTGT
CCCCGTGAGAACTGGATAGATGATCCGAAGTGCAATAGTCTGCAAAAATT
GCTGTCAAGTTGCACAAAGAAATCGGACGAAAAGACGAATGCACTTAAGG
GAAAGGATGAGGAACTAACGGACAACGGGTGTGGGCATATAGATTCAGAA
GGATCCAATCTGCTCATGGCCTGTTTTCTCACACTGATGATCGCCAAGTT
CATATCGGATCATTAATTAGGGATTACCTAGATTTGTTTGTCTGGTTAAA
ATGATTGCATTTAAGCCGATAAGCTTGTCTAATTGCAATTGTCTGGCTTA
TGCCGAGCCCCCAATCGGAATTTTGTTTGGACTTTGACCCGCTATGAGTC
CATCCCGATGACTGCACATTTTCGCTCACGAGACCGTCGTTTAAAATGTG
TTTTTGCTGTGCTCGATTAATTAGTGGATCGTCACGGAACTGGAGTTATA
AAGTAAGCCGACGGTGCCAGACGAAGCTCAGACTGACTAAAAAAATGGCC
CGGCATATAGCCCTGCTGATCTGCTCATTGCTAGCGATGGCTGGCTGTGA
TCCAATCGATGTGGACTGTACTCGCAGACAGGATTTCAATATTGTCAAGG
ACTGCTGTGTCTATCCCACATTTAGGTTTGACCAGTTCAAAAGCCAGTGT
GGTAAATATATGCCAGTTGGTGCTCCCAGAATTTCACCCTGCCTCTATGA
ATGCATTTTCAATAAGACCAACACAGTTGTGGACGGAGCTATTCATCCTG
ACAATGCCCGACTCATGCTGGAGAAGCTTTTCGGTAATCAGGACTTTGAA
GAAGCCTATTTCAATGGTTTAATGGGCTGTTCGGATTCTGTGCAAGAGAT
GATTAGCAACAGGAGGTCACGGCCCCAAAGAAAAACAGAACAATGCTCTC
CATTCTCACTTTTCTATGGAATTTGTGCCCAGAGATATGTCTTCAACCAT
TGTCCATCATCCAGCTGGTCCGGCACTGAATCTTGCGAAATGGCCCGATT
GCAGAACATGAACTGTTCGAAACCATCACGTGGTTCTAGTCATCGCCTTT
AAAGGCATATAATAAAATAATATATGAACATTGTAAAAAAAAAAAAAAAA
AAAAAAAAA

IP02234.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:53:33
Subject Length Description Subject Range Query Range Score Percent Strand
Obp50c-RA 1234 Obp50c-RA 1..1234 1..1234 6155 99.9 Plus
Obp50b-RA 940 Obp50b-RA 419..940 1..522 2595 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10258958..10259697 1..740 3685 99.9 Plus
chr2R 21145070 chr2R 10259916..10260310 840..1234 1975 100 Plus
chr2R 21145070 chr2R 10259761..10259859 741..839 480 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:33:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14371654..14372393 1..740 3685 99.9 Plus
2R 25286936 2R 14372612..14373007 840..1235 1980 100 Plus
2R 25286936 2R 14372457..14372555 741..839 495 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:42:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14372853..14373592 1..740 3685 99.8 Plus
2R 25260384 2R 14373811..14374206 840..1235 1980 100 Plus
2R 25260384 2R 14373656..14373754 741..839 495 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:44:52 has no hits.

IP02234.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:45:30 Download gff for IP02234.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10258958..10259697 1..740 99 -> Plus
chr2R 10259761..10259859 741..839 98 -> Plus
chr2R 10259916..10260310 840..1234 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:17:07 Download gff for IP02234.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50c-RA 1..657 546..1202 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:25:50 Download gff for IP02234.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50c-RB 1..657 546..1202 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:22:17 Download gff for IP02234.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50c-RB 1..657 546..1202 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:09:56 Download gff for IP02234.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50c-RA 1..657 546..1202 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:19:45 Download gff for IP02234.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50c-RC 1..558 645..1202 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:28:24 Download gff for IP02234.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50c-RA 1..1234 1..1234 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:25:50 Download gff for IP02234.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50c-RB 415..1648 1..1234 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:22:17 Download gff for IP02234.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50c-RB 415..1648 1..1234 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:09:56 Download gff for IP02234.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50c-RA 1..1234 1..1234 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:19:45 Download gff for IP02234.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50c-RC 415..1648 1..1234 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:45:30 Download gff for IP02234.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14371654..14372393 1..740 99 -> Plus
2R 14372457..14372555 741..839 100 -> Plus
2R 14372612..14373006 840..1234 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:45:30 Download gff for IP02234.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14371654..14372393 1..740 99 -> Plus
2R 14372457..14372555 741..839 100 -> Plus
2R 14372612..14373006 840..1234 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:45:30 Download gff for IP02234.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14371654..14372393 1..740 99 -> Plus
2R 14372457..14372555 741..839 100 -> Plus
2R 14372612..14373006 840..1234 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:22:17 Download gff for IP02234.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10259159..10259898 1..740 99 -> Plus
arm_2R 10259962..10260060 741..839 100 -> Plus
arm_2R 10260117..10260511 840..1234 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:46:21 Download gff for IP02234.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14372853..14373592 1..740 99 -> Plus
2R 14373656..14373754 741..839 100 -> Plus
2R 14373811..14374205 840..1234 100   Plus

IP02234.hyp Sequence

Translation from 545 to 1201

> IP02234.hyp
MCFCCARLISGSSRNWSYKVSRRCQTKLRLTKKMARHIALLICSLLAMAG
CDPIDVDCTRRQDFNIVKDCCVYPTFRFDQFKSQCGKYMPVGAPRISPCL
YECIFNKTNTVVDGAIHPDNARLMLEKLFGNQDFEEAYFNGLMGCSDSVQ
EMISNRRSRPQRKTEQCSPFSLFYGICAQRYVFNHCPSSSWSGTESCEMA
RLQNMNCSKPSRGSSHRL*

IP02234.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:47:09
Subject Length Description Subject Range Query Range Score Percent Strand
Obp50c-PC 185 CG30072-PC 1..185 34..218 1015 100 Plus
Obp50d-PA 173 CG30074-PA 1..170 34..207 286 30.5 Plus

IP02234.pep Sequence

Translation from 545 to 1201

> IP02234.pep
MCFCCARLISGSSRNWSYKVSRRCQTKLRLTKKMARHIALLICSLLAMAG
CDPIDVDCTRRQDFNIVKDCCVYPTFRFDQFKSQCGKYMPVGAPRISPCL
YECIFNKTNTVVDGAIHPDNARLMLEKLFGNQDFEEAYFNGLMGCSDSVQ
EMISNRRSRPQRKTEQCSPFSLFYGICAQRYVFNHCPSSSWSGTESCEMA
RLQNMNCSKPSRGSSHRL*

IP02234.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:14:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13501-PA 193 GF13501-PA 2..188 34..214 567 55.3 Plus
Dana\GF13502-PA 177 GF13502-PA 20..177 55..213 283 34 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:14:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20450-PA 186 GG20450-PA 1..185 34..218 911 89.7 Plus
Dere\GG20451-PA 174 GG20451-PA 2..170 38..207 279 32.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:14:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19745-PA 166 GH19745-PA 40..158 95..213 199 35.8 Plus
Dgri\GH22122-PA 175 GH22122-PA 28..167 67..211 158 28.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
Obp50c-PC 185 CG30072-PC 1..185 34..218 1015 100 Plus
Obp50d-PA 173 CG30074-PA 1..170 34..207 286 30.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:14:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20279-PA 154 GI20279-PA 4..141 70..207 204 31.7 Plus
Dmoj\GI19255-PA 179 GI19255-PA 32..171 67..211 158 27.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:14:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10689-PA 424 GL10689-PA 216..422 21..217 543 49.8 Plus
Dper\GL10690-PA 187 GL10690-PA 14..186 33..207 299 35.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:14:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp50d-PA 187 GA15625-PA 14..186 33..207 299 35.2 Plus
Dpse\Obp50c-PA 99 GA15623-PA 1..97 124..217 265 50.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:14:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21537-PA 185 GM21537-PA 1..185 34..218 941 92.4 Plus
Dsec\GM21538-PA 173 GM21538-PA 1..170 34..207 265 31 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:14:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp50c-PA 185 GD11047-PA 1..185 34..218 944 93 Plus
Dsim\Obp50d-PA 173 GD11048-PA 1..170 34..207 279 31.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:14:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp50c-PA 188 GJ22008-PA 1..167 34..200 309 36.3 Plus
Dvir\Obp50a-PA 179 GJ20334-PA 32..171 67..211 156 28.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:14:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21472-PA 195 GK21472-PA 2..194 34..218 427 45.6 Plus
Dwil\GK21475-PA 167 GK21475-PA 4..156 55..207 274 32.5 Plus
Dwil\GK19396-PA 179 GK19396-PA 22..173 56..210 271 34 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13581-PA 188 GE13581-PA 1..187 34..218 897 88.8 Plus
Dyak\GE13583-PA 173 GE13583-PA 2..170 38..207 293 33.5 Plus