Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
IP02256.complete Sequence
569 bp (569 high quality bases) assembled on 2005-03-01
GenBank Submission: BT023329
> IP02256.complete
CAATGTTCAACACTAGACTTGCCATTTTTTTGCTTCTTATCGTTGTTTCG
CTTAGCCAAGCTAAGGAAAGCCAACCCTTTGACTTTTTCGAAGGAACCTA
TGACGATTTTATTGATTGTCTGAGAATCAATAATATTACCATTGAAGAGT
ATGAGAAGTTTGACGATACCGACAATTTGGATAATGTCCTCAAGGAAAAT
GTCGAACTGAAGCACAAGTGCAACATTAAGTGTCAACTGGAAAGAGAGCC
AACCAAATGGCTAAATGCTCGGGGTGAAGTCGATCTGAAATCAATGAAAG
CAACCAGTGAGACAGCGGTATCCATATCAAAGTGCATGGAGAAGGCTCCC
CAAGAAACCTGTGCCTACGTCTATAAATTGGTAATATGTGCATTCAAATC
CGGACATTCAGTCATCAAGTTCGATTCATATGAACAAATACAAGAGGAAA
CCGCTGGACTAATAGCTGAACAGCAGGCGGATCTGTTTGATTACGATACC
ATCGATTTATAAAATCAAAACAATGTCGCCATAGTCACAGTAAAAAAAAA
AAAAAAAAAAAAAAAAAAA
IP02256.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:33:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Obp57a.a | 1821 | Obp57a.a | 146..688 | 1..543 | 2715 | 100 | Plus |
Obp57a.b | 1492 | Obp57a.b | 146..688 | 1..543 | 2715 | 100 | Plus |
Obp57a-RA | 688 | Obp57a-RA | 146..688 | 1..543 | 2715 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:00:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 16392084..16392561 | 64..541 | 2360 | 99.6 | Plus |
chr2R | 21145070 | chr2R | 16391970..16392035 | 1..66 | 330 | 100 | Plus |
chr2R | 21145070 | chr2R | 16391305..16391523 | 176..394 | 225 | 73.5 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:33:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:00:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 20505281..20505760 | 64..543 | 2400 | 100 | Plus |
2R | 25286936 | 2R | 20505167..20505232 | 1..66 | 330 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:24:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 20506480..20506959 | 64..543 | 2400 | 100 | Plus |
2R | 25260384 | 2R | 20506366..20506431 | 1..66 | 330 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 18:00:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ZAM | 8435 | ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). | 7607..7759 | 288..440 | 108 | 54.2 | Plus |
IP02256.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:01:03 Download gff for
IP02256.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 16391970..16392034 | 1..65 | 100 | -> | Plus |
chr2R | 16392086..16392561 | 66..541 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:17:08 Download gff for
IP02256.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp57a-RA | 1..510 | 3..512 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:57:18 Download gff for
IP02256.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp57a-RA | 1..510 | 3..512 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:06:47 Download gff for
IP02256.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp57a-RA | 1..510 | 3..512 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:38:07 Download gff for
IP02256.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp57a-RA | 1..510 | 3..512 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:26:27 Download gff for
IP02256.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp57a-RA | 1..510 | 3..512 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:36:36 Download gff for
IP02256.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp57a-RA | 1..541 | 1..541 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:57:18 Download gff for
IP02256.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp57a-RA | 1..541 | 1..541 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:06:47 Download gff for
IP02256.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp57a-RA | 18..558 | 1..541 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:38:08 Download gff for
IP02256.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp57a-RA | 1..541 | 1..541 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:26:27 Download gff for
IP02256.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp57a-RA | 18..558 | 1..541 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:01:03 Download gff for
IP02256.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20505167..20505231 | 1..65 | 100 | -> | Plus |
2R | 20505283..20505758 | 66..541 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:01:03 Download gff for
IP02256.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20505167..20505231 | 1..65 | 100 | -> | Plus |
2R | 20505283..20505758 | 66..541 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:01:03 Download gff for
IP02256.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20505167..20505231 | 1..65 | 100 | -> | Plus |
2R | 20505283..20505758 | 66..541 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:06:47 Download gff for
IP02256.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 16392672..16392736 | 1..65 | 100 | -> | Plus |
arm_2R | 16392788..16393263 | 66..541 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:16:42 Download gff for
IP02256.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20506482..20506957 | 66..541 | 100 | | Plus |
2R | 20506366..20506430 | 1..65 | 100 | -> | Plus |
IP02256.hyp Sequence
Translation from 2 to 511
> IP02256.hyp
MFNTRLAIFLLLIVVSLSQAKESQPFDFFEGTYDDFIDCLRINNITIEEY
EKFDDTDNLDNVLKENVELKHKCNIKCQLEREPTKWLNARGEVDLKSMKA
TSETAVSISKCMEKAPQETCAYVYKLVICAFKSGHSVIKFDSYEQIQEET
AGLIAEQQADLFDYDTIDL*
IP02256.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:47:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Obp57a-PA | 169 | CG30141-PA | 1..169 | 1..169 | 876 | 100 | Plus |
Obp57b-PB | 141 | CG30142-PB | 1..138 | 1..138 | 408 | 55.1 | Plus |
Obp57b-PA | 141 | CG30142-PA | 1..138 | 1..138 | 408 | 55.1 | Plus |
IP02256.pep Sequence
Translation from 2 to 511
> IP02256.pep
MFNTRLAIFLLLIVVSLSQAKESQPFDFFEGTYDDFIDCLRINNITIEEY
EKFDDTDNLDNVLKENVELKHKCNIKCQLEREPTKWLNARGEVDLKSMKA
TSETAVSISKCMEKAPQETCAYVYKLVICAFKSGHSVIKFDSYEQIQEET
AGLIAEQQADLFDYDTIDL*
IP02256.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:42:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF12267-PA | 179 | GF12267-PA | 11..148 | 11..153 | 384 | 51.7 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:42:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22036-PA | 170 | GG22036-PA | 1..159 | 1..158 | 706 | 84.4 | Plus |
Dere\GG22035-PA | 140 | GG22035-PA | 1..137 | 1..138 | 399 | 53.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Obp57a-PA | 169 | CG30141-PA | 1..169 | 1..169 | 876 | 100 | Plus |
Obp57b-PB | 141 | CG30142-PB | 1..138 | 1..138 | 408 | 55.1 | Plus |
Obp57b-PA | 141 | CG30142-PA | 1..138 | 1..138 | 408 | 55.1 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:42:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM22019-PA | 169 | GM22019-PA | 1..169 | 1..169 | 832 | 93.5 | Plus |
Dsec\GM22018-PA | 141 | GM22018-PA | 1..138 | 1..138 | 417 | 55.1 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:42:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\Obp57a-PA | 167 | GD11518-PA | 1..167 | 1..169 | 769 | 87 | Plus |
Dsim\Obp57b-PA | 141 | GD11517-PA | 1..138 | 1..138 | 410 | 53.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:42:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE12116-PA | 168 | GE12116-PA | 1..157 | 1..158 | 681 | 81 | Plus |
Dyak\GE12115-PA | 140 | GE12115-PA | 1..137 | 1..138 | 404 | 54.3 | Plus |