Clone IP02256 Report

Search the DGRC for IP02256

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:22
Well:56
Vector:pOT2
Associated Gene/TranscriptObp57a-RA
Protein status:IP02256.pep: gold
Preliminary Size:510
Sequenced Size:569

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30141 2005-01-01 Successful iPCR screen
Obp57a 2008-04-29 Release 5.5 accounting
Obp57a 2008-08-15 Release 5.9 accounting
Obp57a 2008-12-18 5.12 accounting

Clone Sequence Records

IP02256.complete Sequence

569 bp (569 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023329

> IP02256.complete
CAATGTTCAACACTAGACTTGCCATTTTTTTGCTTCTTATCGTTGTTTCG
CTTAGCCAAGCTAAGGAAAGCCAACCCTTTGACTTTTTCGAAGGAACCTA
TGACGATTTTATTGATTGTCTGAGAATCAATAATATTACCATTGAAGAGT
ATGAGAAGTTTGACGATACCGACAATTTGGATAATGTCCTCAAGGAAAAT
GTCGAACTGAAGCACAAGTGCAACATTAAGTGTCAACTGGAAAGAGAGCC
AACCAAATGGCTAAATGCTCGGGGTGAAGTCGATCTGAAATCAATGAAAG
CAACCAGTGAGACAGCGGTATCCATATCAAAGTGCATGGAGAAGGCTCCC
CAAGAAACCTGTGCCTACGTCTATAAATTGGTAATATGTGCATTCAAATC
CGGACATTCAGTCATCAAGTTCGATTCATATGAACAAATACAAGAGGAAA
CCGCTGGACTAATAGCTGAACAGCAGGCGGATCTGTTTGATTACGATACC
ATCGATTTATAAAATCAAAACAATGTCGCCATAGTCACAGTAAAAAAAAA
AAAAAAAAAAAAAAAAAAA

IP02256.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Obp57a.a 1821 Obp57a.a 146..688 1..543 2715 100 Plus
Obp57a.b 1492 Obp57a.b 146..688 1..543 2715 100 Plus
Obp57a-RA 688 Obp57a-RA 146..688 1..543 2715 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16392084..16392561 64..541 2360 99.6 Plus
chr2R 21145070 chr2R 16391970..16392035 1..66 330 100 Plus
chr2R 21145070 chr2R 16391305..16391523 176..394 225 73.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:33:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:00:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20505281..20505760 64..543 2400 100 Plus
2R 25286936 2R 20505167..20505232 1..66 330 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20506480..20506959 64..543 2400 100 Plus
2R 25260384 2R 20506366..20506431 1..66 330 100 Plus
Blast to na_te.dros performed 2019-03-16 18:00:27
Subject Length Description Subject Range Query Range Score Percent Strand
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 7607..7759 288..440 108 54.2 Plus

IP02256.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:01:03 Download gff for IP02256.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16391970..16392034 1..65 100 -> Plus
chr2R 16392086..16392561 66..541 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:17:08 Download gff for IP02256.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57a-RA 1..510 3..512 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:57:18 Download gff for IP02256.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57a-RA 1..510 3..512 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:06:47 Download gff for IP02256.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57a-RA 1..510 3..512 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:38:07 Download gff for IP02256.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57a-RA 1..510 3..512 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:26:27 Download gff for IP02256.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57a-RA 1..510 3..512 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:36:36 Download gff for IP02256.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57a-RA 1..541 1..541 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:57:18 Download gff for IP02256.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57a-RA 1..541 1..541 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:06:47 Download gff for IP02256.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57a-RA 18..558 1..541 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:38:08 Download gff for IP02256.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57a-RA 1..541 1..541 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:26:27 Download gff for IP02256.complete
Subject Subject Range Query Range Percent Splice Strand
Obp57a-RA 18..558 1..541 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:01:03 Download gff for IP02256.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20505167..20505231 1..65 100 -> Plus
2R 20505283..20505758 66..541 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:01:03 Download gff for IP02256.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20505167..20505231 1..65 100 -> Plus
2R 20505283..20505758 66..541 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:01:03 Download gff for IP02256.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20505167..20505231 1..65 100 -> Plus
2R 20505283..20505758 66..541 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:06:47 Download gff for IP02256.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16392672..16392736 1..65 100 -> Plus
arm_2R 16392788..16393263 66..541 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:16:42 Download gff for IP02256.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20506482..20506957 66..541 100   Plus
2R 20506366..20506430 1..65 100 -> Plus

IP02256.hyp Sequence

Translation from 2 to 511

> IP02256.hyp
MFNTRLAIFLLLIVVSLSQAKESQPFDFFEGTYDDFIDCLRINNITIEEY
EKFDDTDNLDNVLKENVELKHKCNIKCQLEREPTKWLNARGEVDLKSMKA
TSETAVSISKCMEKAPQETCAYVYKLVICAFKSGHSVIKFDSYEQIQEET
AGLIAEQQADLFDYDTIDL*

IP02256.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:47:23
Subject Length Description Subject Range Query Range Score Percent Strand
Obp57a-PA 169 CG30141-PA 1..169 1..169 876 100 Plus
Obp57b-PB 141 CG30142-PB 1..138 1..138 408 55.1 Plus
Obp57b-PA 141 CG30142-PA 1..138 1..138 408 55.1 Plus

IP02256.pep Sequence

Translation from 2 to 511

> IP02256.pep
MFNTRLAIFLLLIVVSLSQAKESQPFDFFEGTYDDFIDCLRINNITIEEY
EKFDDTDNLDNVLKENVELKHKCNIKCQLEREPTKWLNARGEVDLKSMKA
TSETAVSISKCMEKAPQETCAYVYKLVICAFKSGHSVIKFDSYEQIQEET
AGLIAEQQADLFDYDTIDL*

IP02256.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:42:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12267-PA 179 GF12267-PA 11..148 11..153 384 51.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:42:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22036-PA 170 GG22036-PA 1..159 1..158 706 84.4 Plus
Dere\GG22035-PA 140 GG22035-PA 1..137 1..138 399 53.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:35
Subject Length Description Subject Range Query Range Score Percent Strand
Obp57a-PA 169 CG30141-PA 1..169 1..169 876 100 Plus
Obp57b-PB 141 CG30142-PB 1..138 1..138 408 55.1 Plus
Obp57b-PA 141 CG30142-PA 1..138 1..138 408 55.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22019-PA 169 GM22019-PA 1..169 1..169 832 93.5 Plus
Dsec\GM22018-PA 141 GM22018-PA 1..138 1..138 417 55.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp57a-PA 167 GD11518-PA 1..167 1..169 769 87 Plus
Dsim\Obp57b-PA 141 GD11517-PA 1..138 1..138 410 53.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12116-PA 168 GE12116-PA 1..157 1..158 681 81 Plus
Dyak\GE12115-PA 140 GE12115-PA 1..137 1..138 404 54.3 Plus