Clone IP02288 Report

Search the DGRC for IP02288

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:22
Well:88
Vector:pOT2
Associated Gene/TranscriptObp56i-RA
Protein status:IP02288.pep: gold
Preliminary Size:423
Sequenced Size:590

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30448 2005-01-01 Successful iPCR screen
Obp56i 2008-04-29 Release 5.5 accounting
Obp56i 2008-08-15 Release 5.9 accounting
Obp56i 2008-12-18 5.12 accounting

Clone Sequence Records

IP02288.complete Sequence

590 bp (590 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023325

> IP02288.complete
ATACATGTATGACCTACCCTGCTGAAAAATGCATTTTTTCACCTGCTGTG
CATTATTGTTAGTCGTCGTTACATTACCAACATGTTTCGTACAAGCAGGT
CCCATTAAGGATCAATGCATGGCGGCGGCGGGCATCACAGCACAAGATGT
TGCGAATCGTCATGAGACCGACGACCCTGGCCATAGTGTCAAGTGCTTTT
TCCGCTGTTTTCTAGAAAACATTGGCATTATCGCCGATAACCAGATAATA
CCCGGTGCTTTTGACCGAGTTCTAGGCCATATAGTTACCGCGGAAGCCGT
AGAGCGAATGGAAGCGACGTGTAATATGATTAAGAGCGAGACATCCCATG
ACGAGTCTTGTGAATTCGCCTGGCAAATCTCCGAGTGCTACGAAGGAGTA
AGATTATCAGATGTTAAGAAGGGCCAAAGAACTCGAAATCACAGAGGATA
AAGTATGCATTAAAATTGTTTTAAATTTAATGTTATAAATAAGGCGTTCA
CTTGATTTTTAAGAAATTAAAGTACTACTTCACCAAGTAGTAGAAACAAC
AACAGTTCGATTACCACCGAAAAAAAAAAAAAAAAAAAAA

IP02288.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56i-RA 569 Obp56i-RA 1..569 1..569 2845 100 Plus
Obp56i.b 1624 Obp56i.b 460..943 89..572 2420 100 Plus
Obp56i.a 940 Obp56i.a 460..940 89..569 2405 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:10:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15755433..15755913 89..569 2390 99.8 Plus
chr2R 21145070 chr2R 15755287..15755377 1..91 455 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:34:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:10:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19868234..19868717 89..572 2420 100 Plus
2R 25286936 2R 19868088..19868178 1..91 455 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:24:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19869433..19869916 89..572 2420 100 Plus
2R 25260384 2R 19869287..19869377 1..91 455 100 Plus
Blast to na_te.dros performed 2019-03-16 14:10:22
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 6625..6789 563..401 143 58.1 Minus
Dvir\Penelope 4158 Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). 522..582 434..496 111 68.3 Plus
Dvir\Penelope 4158 Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). 3303..3363 434..496 111 68.3 Plus
Penelope 804 Penelope 804bp Derived from AF418572 (AF418572) (Rel. 70, Last updated, Version 3). 77..137 434..496 111 68.3 Plus

IP02288.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:11:24 Download gff for IP02288.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15755287..15755374 1..88 100 -> Plus
chr2R 15755433..15755913 89..569 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:17:13 Download gff for IP02288.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56i-RA 1..423 29..451 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:57:56 Download gff for IP02288.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56i-RA 1..423 29..451 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:47 Download gff for IP02288.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56i-RA 1..423 29..451 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:38:43 Download gff for IP02288.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56i-RA 1..423 29..451 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:28:24 Download gff for IP02288.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56i-RA 1..423 29..451 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:37:46 Download gff for IP02288.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56i-RA 1..423 29..451 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:57:56 Download gff for IP02288.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56i-RA 1..569 1..569 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:47 Download gff for IP02288.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56i-RA 1..569 1..569 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:38:43 Download gff for IP02288.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56i-RA 1..423 29..451 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:28:24 Download gff for IP02288.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56i-RA 1..569 1..569 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:11:24 Download gff for IP02288.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19868088..19868175 1..88 100 -> Plus
2R 19868234..19868714 89..569 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:11:24 Download gff for IP02288.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19868088..19868175 1..88 100 -> Plus
2R 19868234..19868714 89..569 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:11:24 Download gff for IP02288.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19868088..19868175 1..88 100 -> Plus
2R 19868234..19868714 89..569 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:47 Download gff for IP02288.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15755593..15755680 1..88 100 -> Plus
arm_2R 15755739..15756219 89..569 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:17:22 Download gff for IP02288.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19869433..19869913 89..569 100   Plus
2R 19869287..19869374 1..88 100 -> Plus

IP02288.hyp Sequence

Translation from 28 to 450

> IP02288.hyp
MHFFTCCALLLVVVTLPTCFVQAGPIKDQCMAAAGITAQDVANRHETDDP
GHSVKCFFRCFLENIGIIADNQIIPGAFDRVLGHIVTAEAVERMEATCNM
IKSETSHDESCEFAWQISECYEGVRLSDVKKGQRTRNHRG*

IP02288.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:47:50
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56i-PA 140 CG30448-PA 1..140 1..140 753 100 Plus
Obp56i-PB 129 CG30448-PB 1..129 12..140 644 94.6 Plus
Obp56d-PB 131 CG11218-PB 35..124 19..121 136 32 Plus
Obp56d-PA 131 CG11218-PA 35..124 19..121 136 32 Plus

IP02288.pep Sequence

Translation from 28 to 450

> IP02288.pep
MHFFTCCALLLVVVTLPTCFVQAGPIKDQCMAAAGITAQDVANRHETDDP
GHSVKCFFRCFLENIGIIADNQIIPGAFDRVLGHIVTAEAVERMEATCNM
IKSETSHDESCEFAWQISECYEGVRLSDVKKGQRTRNHRG*

IP02288.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13167-PA 131 GF13167-PA 35..124 19..121 132 34 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22004-PA 136 GG22004-PA 1..136 1..140 533 70.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56i-PA 140 CG30448-PA 1..140 1..140 753 100 Plus
Obp56i-PB 129 CG30448-PB 1..129 12..140 644 94.6 Plus
Obp56d-PB 131 CG11218-PB 35..124 19..121 136 32 Plus
Obp56d-PA 131 CG11218-PA 35..124 19..121 136 32 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11722-PA 131 GL11722-PA 35..124 19..121 139 34 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp56d-PA 131 GA10849-PA 35..124 19..121 139 34 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21985-PA 140 GM21985-PA 1..140 1..140 664 87.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:43:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp56i-PA 140 GD11484-PA 1..140 1..140 674 89.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:43:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15692-PA 132 GK15692-PA 36..125 19..121 151 36.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:43:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12084-PA 140 GE12084-PA 1..139 1..139 496 62.6 Plus