BDGP Sequence Production Resources |
Search the DGRC for IP02288
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 22 |
Well: | 88 |
Vector: | pOT2 |
Associated Gene/Transcript | Obp56i-RA |
Protein status: | IP02288.pep: gold |
Preliminary Size: | 423 |
Sequenced Size: | 590 |
Gene | Date | Evidence |
---|---|---|
CG30448 | 2005-01-01 | Successful iPCR screen |
Obp56i | 2008-04-29 | Release 5.5 accounting |
Obp56i | 2008-08-15 | Release 5.9 accounting |
Obp56i | 2008-12-18 | 5.12 accounting |
590 bp (590 high quality bases) assembled on 2005-03-01
GenBank Submission: BT023325
> IP02288.complete ATACATGTATGACCTACCCTGCTGAAAAATGCATTTTTTCACCTGCTGTG CATTATTGTTAGTCGTCGTTACATTACCAACATGTTTCGTACAAGCAGGT CCCATTAAGGATCAATGCATGGCGGCGGCGGGCATCACAGCACAAGATGT TGCGAATCGTCATGAGACCGACGACCCTGGCCATAGTGTCAAGTGCTTTT TCCGCTGTTTTCTAGAAAACATTGGCATTATCGCCGATAACCAGATAATA CCCGGTGCTTTTGACCGAGTTCTAGGCCATATAGTTACCGCGGAAGCCGT AGAGCGAATGGAAGCGACGTGTAATATGATTAAGAGCGAGACATCCCATG ACGAGTCTTGTGAATTCGCCTGGCAAATCTCCGAGTGCTACGAAGGAGTA AGATTATCAGATGTTAAGAAGGGCCAAAGAACTCGAAATCACAGAGGATA AAGTATGCATTAAAATTGTTTTAAATTTAATGTTATAAATAAGGCGTTCA CTTGATTTTTAAGAAATTAAAGTACTACTTCACCAAGTAGTAGAAACAAC AACAGTTCGATTACCACCGAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
roo | 9092 | roo DM_ROO 9092bp | 6625..6789 | 563..401 | 143 | 58.1 | Minus |
Dvir\Penelope | 4158 | Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). | 522..582 | 434..496 | 111 | 68.3 | Plus |
Dvir\Penelope | 4158 | Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). | 3303..3363 | 434..496 | 111 | 68.3 | Plus |
Penelope | 804 | Penelope 804bp Derived from AF418572 (AF418572) (Rel. 70, Last updated, Version 3). | 77..137 | 434..496 | 111 | 68.3 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 15755287..15755374 | 1..88 | 100 | -> | Plus |
chr2R | 15755433..15755913 | 89..569 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56i-RA | 1..423 | 29..451 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56i-RA | 1..423 | 29..451 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56i-RA | 1..423 | 29..451 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56i-RA | 1..423 | 29..451 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56i-RA | 1..423 | 29..451 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56i-RA | 1..423 | 29..451 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56i-RA | 1..569 | 1..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56i-RA | 1..569 | 1..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56i-RA | 1..423 | 29..451 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56i-RA | 1..569 | 1..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 19868088..19868175 | 1..88 | 100 | -> | Plus |
2R | 19868234..19868714 | 89..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 19868088..19868175 | 1..88 | 100 | -> | Plus |
2R | 19868234..19868714 | 89..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 19868088..19868175 | 1..88 | 100 | -> | Plus |
2R | 19868234..19868714 | 89..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 15755593..15755680 | 1..88 | 100 | -> | Plus |
arm_2R | 15755739..15756219 | 89..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 19869433..19869913 | 89..569 | 100 | Plus | |
2R | 19869287..19869374 | 1..88 | 100 | -> | Plus |
Translation from 28 to 450
> IP02288.hyp MHFFTCCALLLVVVTLPTCFVQAGPIKDQCMAAAGITAQDVANRHETDDP GHSVKCFFRCFLENIGIIADNQIIPGAFDRVLGHIVTAEAVERMEATCNM IKSETSHDESCEFAWQISECYEGVRLSDVKKGQRTRNHRG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Obp56i-PA | 140 | CG30448-PA | 1..140 | 1..140 | 753 | 100 | Plus |
Obp56i-PB | 129 | CG30448-PB | 1..129 | 12..140 | 644 | 94.6 | Plus |
Obp56d-PB | 131 | CG11218-PB | 35..124 | 19..121 | 136 | 32 | Plus |
Obp56d-PA | 131 | CG11218-PA | 35..124 | 19..121 | 136 | 32 | Plus |
Translation from 28 to 450
> IP02288.pep MHFFTCCALLLVVVTLPTCFVQAGPIKDQCMAAAGITAQDVANRHETDDP GHSVKCFFRCFLENIGIIADNQIIPGAFDRVLGHIVTAEAVERMEATCNM IKSETSHDESCEFAWQISECYEGVRLSDVKKGQRTRNHRG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13167-PA | 131 | GF13167-PA | 35..124 | 19..121 | 132 | 34 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22004-PA | 136 | GG22004-PA | 1..136 | 1..140 | 533 | 70.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Obp56i-PA | 140 | CG30448-PA | 1..140 | 1..140 | 753 | 100 | Plus |
Obp56i-PB | 129 | CG30448-PB | 1..129 | 12..140 | 644 | 94.6 | Plus |
Obp56d-PB | 131 | CG11218-PB | 35..124 | 19..121 | 136 | 32 | Plus |
Obp56d-PA | 131 | CG11218-PA | 35..124 | 19..121 | 136 | 32 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11722-PA | 131 | GL11722-PA | 35..124 | 19..121 | 139 | 34 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\Obp56d-PA | 131 | GA10849-PA | 35..124 | 19..121 | 139 | 34 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21985-PA | 140 | GM21985-PA | 1..140 | 1..140 | 664 | 87.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\Obp56i-PA | 140 | GD11484-PA | 1..140 | 1..140 | 674 | 89.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15692-PA | 132 | GK15692-PA | 36..125 | 19..121 | 151 | 36.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12084-PA | 140 | GE12084-PA | 1..139 | 1..139 | 496 | 62.6 | Plus |