Clone IP02289 Report

Search the DGRC for IP02289

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:22
Well:89
Vector:pOT2
Associated Gene/TranscriptObp56f-RA
Protein status:IP02289.pep: gold
Preliminary Size:378
Sequenced Size:524

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30450 2005-01-01 Successful iPCR screen
Obp56f 2008-04-29 Release 5.5 accounting
Obp56f 2008-08-15 Release 5.9 accounting
Obp56f 2008-12-18 5.12 accounting

Clone Sequence Records

IP02289.complete Sequence

524 bp assembled on 2006-11-09

GenBank Submission: BT023320

> IP02289.complete
TCATTATGAAAGTATTCCTGTTGTTCATTTTCATCTCTGCTATCTGGCTC
CAAGCATTTTGTATGAAATCTTCTGAAAAAATAAAAGCCTGCTTGAAACG
GCAGCTGGGGTATACAATTACAGAAAATACAAAATTTGATGCTAAAGAAG
ACTCTCTTCAAAGCAAGTGTTTTTATCACTGCTTACTGGAAGTGAAAGGT
GTTATTGCAAATGATGCGATCAGTTCGGAGCAACCGAGGAAAGTACTTGA
AAAAAAGTATGGCATTACTGACACAGATGAATTGGAAAAGGCTGAAGAAA
AGTGTCATTCCATCAAGGCTTCAGGAAAATGTGAATTGGGCTACGAAATC
TTGAAATGCTATCAGTCCATTACCAAGCATTAGACTTCTAAACATGCTAT
TATGTACCTGGTGTTCGGATAAACATTCAACTTATGCACATCACACTTTA
AAACGTTAATTTTTGAGAAACTTCACCAATGTACATAATAAAGTGTAAAA
CCGAAAACTAAAAAAAAAAAAAAA

IP02289.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:12:40
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56f-RA 636 Obp56f-RA 120..630 1..511 2555 100 Plus
nc_8077.a 1204 nc_8077.a 1126..1204 65..143 395 100 Plus
nc_8077.a 1204 nc_8077.a 1008..1072 1..65 325 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15600738..15601182 65..509 2225 100 Plus
chr2R 21145070 chr2R 15600620..15600684 1..65 310 98.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:34:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19713532..19713978 65..511 2235 100 Plus
2R 25286936 2R 19713414..19713478 1..65 325 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19714731..19715177 65..511 2235 100 Plus
2R 25260384 2R 19714613..19714677 1..65 325 100 Plus
Blast to na_te.dros performed on 2019-03-16 04:37:14 has no hits.

IP02289.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:37:52 Download gff for IP02289.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15600620..15600684 1..65 98 -> Plus
chr2R 15600739..15601182 66..509 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:17:14 Download gff for IP02289.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56f-RA 1..378 6..383 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:20:09 Download gff for IP02289.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56f-RA 1..378 6..383 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:37:05 Download gff for IP02289.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56f-RA 1..378 6..383 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:37:01 Download gff for IP02289.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56f-RA 1..378 6..383 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:46:35 Download gff for IP02289.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56f-RA 1..378 6..383 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:48:26 Download gff for IP02289.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56f-RA 1..378 6..383 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:20:09 Download gff for IP02289.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56f-RA 1..509 1..509 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:37:05 Download gff for IP02289.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56f-RA 20..528 1..509 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:37:02 Download gff for IP02289.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56f-RA 1..378 6..383 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:46:35 Download gff for IP02289.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56f-RA 20..528 1..509 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:37:52 Download gff for IP02289.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19713414..19713478 1..65 100 -> Plus
2R 19713533..19713976 66..509 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:37:52 Download gff for IP02289.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19713414..19713478 1..65 100 -> Plus
2R 19713533..19713976 66..509 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:37:52 Download gff for IP02289.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19713414..19713478 1..65 100 -> Plus
2R 19713533..19713976 66..509 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:37:05 Download gff for IP02289.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15601038..15601481 66..509 100   Plus
arm_2R 15600919..15600983 1..65 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:49:16 Download gff for IP02289.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19714613..19714677 1..65 100 -> Plus
2R 19714732..19715175 66..509 100   Plus

IP02289.hyp Sequence

Translation from 2 to 382

> IP02289.hyp
IMKVFLLFIFISAIWLQAFCMKSSEKIKACLKRQLGYTITENTKFDAKED
SLQSKCFYHCLLEVKGVIANDAISSEQPRKVLEKKYGITDTDELEKAEEK
CHSIKASGKCELGYEILKCYQSITKH*

IP02289.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:47:53
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56f-PA 125 CG30450-PA 1..125 2..126 653 100 Plus
Obp56e-PA 132 CG8462-PA 1..125 2..120 135 29 Plus

IP02289.pep Sequence

Translation from 5 to 382

> IP02289.pep
MKVFLLFIFISAIWLQAFCMKSSEKIKACLKRQLGYTITENTKFDAKEDS
LQSKCFYHCLLEVKGVIANDAISSEQPRKVLEKKYGITDTDELEKAEEKC
HSIKASGKCELGYEILKCYQSITKH*

IP02289.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21997-PA 125 GG21997-PA 1..125 1..125 445 64 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56f-PA 125 CG30450-PA 1..125 1..125 653 100 Plus
Obp56e-PA 132 CG8462-PA 1..125 1..119 135 29 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18537-PA 132 GI18537-PA 63..125 54..119 134 42.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:39:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23192-PA 127 GM23192-PA 1..127 1..125 554 86.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:39:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp56f-PA 125 GD11479-PA 1..125 1..125 580 86.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:39:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12076-PA 125 GE12076-PA 1..125 1..125 486 73.6 Plus