IP02289.complete Sequence
524 bp assembled on 2006-11-09
GenBank Submission: BT023320
> IP02289.complete
TCATTATGAAAGTATTCCTGTTGTTCATTTTCATCTCTGCTATCTGGCTC
CAAGCATTTTGTATGAAATCTTCTGAAAAAATAAAAGCCTGCTTGAAACG
GCAGCTGGGGTATACAATTACAGAAAATACAAAATTTGATGCTAAAGAAG
ACTCTCTTCAAAGCAAGTGTTTTTATCACTGCTTACTGGAAGTGAAAGGT
GTTATTGCAAATGATGCGATCAGTTCGGAGCAACCGAGGAAAGTACTTGA
AAAAAAGTATGGCATTACTGACACAGATGAATTGGAAAAGGCTGAAGAAA
AGTGTCATTCCATCAAGGCTTCAGGAAAATGTGAATTGGGCTACGAAATC
TTGAAATGCTATCAGTCCATTACCAAGCATTAGACTTCTAAACATGCTAT
TATGTACCTGGTGTTCGGATAAACATTCAACTTATGCACATCACACTTTA
AAACGTTAATTTTTGAGAAACTTCACCAATGTACATAATAAAGTGTAAAA
CCGAAAACTAAAAAAAAAAAAAAA
IP02289.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:12:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Obp56f-RA | 636 | Obp56f-RA | 120..630 | 1..511 | 2555 | 100 | Plus |
nc_8077.a | 1204 | nc_8077.a | 1126..1204 | 65..143 | 395 | 100 | Plus |
nc_8077.a | 1204 | nc_8077.a | 1008..1072 | 1..65 | 325 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:37:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 15600738..15601182 | 65..509 | 2225 | 100 | Plus |
chr2R | 21145070 | chr2R | 15600620..15600684 | 1..65 | 310 | 98.5 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:34:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:37:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 19713532..19713978 | 65..511 | 2235 | 100 | Plus |
2R | 25286936 | 2R | 19713414..19713478 | 1..65 | 325 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 19714731..19715177 | 65..511 | 2235 | 100 | Plus |
2R | 25260384 | 2R | 19714613..19714677 | 1..65 | 325 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 04:37:14 has no hits.
IP02289.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:37:52 Download gff for
IP02289.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 15600620..15600684 | 1..65 | 98 | -> | Plus |
chr2R | 15600739..15601182 | 66..509 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:17:14 Download gff for
IP02289.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp56f-RA | 1..378 | 6..383 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:20:09 Download gff for
IP02289.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp56f-RA | 1..378 | 6..383 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:37:05 Download gff for
IP02289.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp56f-RA | 1..378 | 6..383 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:37:01 Download gff for
IP02289.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp56f-RA | 1..378 | 6..383 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:46:35 Download gff for
IP02289.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp56f-RA | 1..378 | 6..383 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:48:26 Download gff for
IP02289.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp56f-RA | 1..378 | 6..383 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:20:09 Download gff for
IP02289.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp56f-RA | 1..509 | 1..509 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:37:05 Download gff for
IP02289.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp56f-RA | 20..528 | 1..509 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:37:02 Download gff for
IP02289.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp56f-RA | 1..378 | 6..383 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:46:35 Download gff for
IP02289.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Obp56f-RA | 20..528 | 1..509 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:37:52 Download gff for
IP02289.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 19713414..19713478 | 1..65 | 100 | -> | Plus |
2R | 19713533..19713976 | 66..509 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:37:52 Download gff for
IP02289.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 19713414..19713478 | 1..65 | 100 | -> | Plus |
2R | 19713533..19713976 | 66..509 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:37:52 Download gff for
IP02289.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 19713414..19713478 | 1..65 | 100 | -> | Plus |
2R | 19713533..19713976 | 66..509 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:37:05 Download gff for
IP02289.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 15601038..15601481 | 66..509 | 100 | | Plus |
arm_2R | 15600919..15600983 | 1..65 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:49:16 Download gff for
IP02289.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 19714613..19714677 | 1..65 | 100 | -> | Plus |
2R | 19714732..19715175 | 66..509 | 100 | | Plus |
IP02289.hyp Sequence
Translation from 2 to 382
> IP02289.hyp
IMKVFLLFIFISAIWLQAFCMKSSEKIKACLKRQLGYTITENTKFDAKED
SLQSKCFYHCLLEVKGVIANDAISSEQPRKVLEKKYGITDTDELEKAEEK
CHSIKASGKCELGYEILKCYQSITKH*
IP02289.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:47:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Obp56f-PA | 125 | CG30450-PA | 1..125 | 2..126 | 653 | 100 | Plus |
Obp56e-PA | 132 | CG8462-PA | 1..125 | 2..120 | 135 | 29 | Plus |
IP02289.pep Sequence
Translation from 5 to 382
> IP02289.pep
MKVFLLFIFISAIWLQAFCMKSSEKIKACLKRQLGYTITENTKFDAKEDS
LQSKCFYHCLLEVKGVIANDAISSEQPRKVLEKKYGITDTDELEKAEEKC
HSIKASGKCELGYEILKCYQSITKH*
IP02289.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:39:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG21997-PA | 125 | GG21997-PA | 1..125 | 1..125 | 445 | 64 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Obp56f-PA | 125 | CG30450-PA | 1..125 | 1..125 | 653 | 100 | Plus |
Obp56e-PA | 132 | CG8462-PA | 1..125 | 1..119 | 135 | 29 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:39:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI18537-PA | 132 | GI18537-PA | 63..125 | 54..119 | 134 | 42.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:39:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM23192-PA | 127 | GM23192-PA | 1..127 | 1..125 | 554 | 86.6 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:39:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\Obp56f-PA | 125 | GD11479-PA | 1..125 | 1..125 | 580 | 86.4 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:39:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE12076-PA | 125 | GE12076-PA | 1..125 | 1..125 | 486 | 73.6 | Plus |