Clone IP02321 Report

Search the DGRC for IP02321

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:23
Well:21
Vector:pOT2
Associated Gene/TranscriptRpb7-RA
Protein status:IP02321.pep: gold
Preliminary Size:522
Sequenced Size:732

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31155 2005-01-01 Successful iPCR screen
Rpb7 2008-04-29 Release 5.5 accounting
Rpb7 2008-08-15 Release 5.9 accounting
Rpb7 2008-12-18 5.12 accounting

Clone Sequence Records

IP02321.complete Sequence

732 bp (732 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023312

> IP02321.complete
TTTACTTTAGTTTTTTACCTTAAATTTAATTAACAATGTTTTACCACATA
TCGCTGGAGCAAGAGATTCTGCTTCATCCACGTTACTTTGGCCCGCAACT
GCTGGAGACCGTGAAGCAGAAACTCTACTCCGAAGTGGAGGGCACCTGCA
CGGGAAAGTACGGATTCGTGATAGCGGTGACGACGATAGATCAAATCGGA
TCGGGTGTCATCCAGCCGGGCCAGGGATTTGTGGTGTATCCGGTCAAGTA
CAAAGCTATCGTCTTTCGGCCATTTAAGGGCGAAGTTCTGGACGCAGTGG
TCAAGCAGATCAACAAAGTGGGCATGTTTGCAGAGATCGGCCCGCTGTCC
TGCTTCATTTCGCATCATTCTATTCCCGCCGACATGCAGTTCTGCCCGAA
TGGGAATCCGCCCTGCTATAAGAGTAAAGATGAGGATGTGGTTATCTCCG
GAGAGGATAAGATTCGGCTGAAGATTGTGGGCACACGAGTAGATGCCACT
GGAATTTTTGCAATTGGCACTTTGATGGACGACTACTTGGGATTGGTGTC
CAACTAAATTCAATCGTTTTGCGTACAATTTATATATATATATATATTAA
ACTTTAATGAAATGCATTTAGACAGTTAAACATCTATGTGTATATAGTAA
TAAATATGTCTGTACTTTATAAGATTTGATTTCAATTAAAGGTACGTTAC
ATTTGTAAAAAAAAAAAAAAAAAAAAAAAAAA

IP02321.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb7-RA 831 Rpb7-RA 98..805 1..708 3540 100 Plus
CG12241.a 2936 CG12241.a 2814..2936 708..586 615 100 Minus
CG12241-RA 3013 CG12241-RA 2891..3013 708..586 615 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:45:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11047331..11047651 368..48 1590 99.7 Minus
chr3R 27901430 chr3R 11046881..11047078 706..507 920 98.5 Minus
chr3R 27901430 chr3R 11047136..11047273 506..369 690 100 Minus
chr3R 27901430 chr3R 11047709..11047755 47..1 235 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:34:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:45:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15222703..15223023 368..48 1605 100 Minus
3R 32079331 3R 15222249..15222450 708..507 1010 100 Minus
3R 32079331 3R 15222508..15222645 506..369 690 100 Minus
3R 32079331 3R 15223081..15223127 47..1 235 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:43:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14963534..14963854 368..48 1605 100 Minus
3R 31820162 3R 14963080..14963281 708..507 1010 100 Minus
3R 31820162 3R 14963339..14963476 506..369 690 100 Minus
3R 31820162 3R 14963912..14963958 47..1 235 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:45:56 has no hits.

IP02321.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:46:49 Download gff for IP02321.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11047136..11047273 369..506 100 <- Minus
chr3R 11047331..11047651 48..368 99 <- Minus
chr3R 11047709..11047755 1..47 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:17:20 Download gff for IP02321.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb7-RA 1..522 36..557 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:26:58 Download gff for IP02321.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb7-RA 1..522 36..557 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:39:28 Download gff for IP02321.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb7-RA 1..522 36..557 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:10:58 Download gff for IP02321.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb7-RA 1..522 36..557 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:15:05 Download gff for IP02321.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb7-RA 1..522 36..557 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:29:58 Download gff for IP02321.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb7-RA 1..706 1..706 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:26:58 Download gff for IP02321.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb7-RA 1..706 1..706 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:39:28 Download gff for IP02321.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb7-RA 54..759 1..706 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:10:58 Download gff for IP02321.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb7-RA 1..706 1..706 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:15:05 Download gff for IP02321.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb7-RA 54..759 1..706 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:49 Download gff for IP02321.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15222703..15223023 48..368 100 <- Minus
3R 15222251..15222450 507..706 100 <- Minus
3R 15222508..15222645 369..506 100 <- Minus
3R 15223081..15223127 1..47 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:49 Download gff for IP02321.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15222703..15223023 48..368 100 <- Minus
3R 15222251..15222450 507..706 100 <- Minus
3R 15222508..15222645 369..506 100 <- Minus
3R 15223081..15223127 1..47 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:49 Download gff for IP02321.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15222703..15223023 48..368 100 <- Minus
3R 15222251..15222450 507..706 100 <- Minus
3R 15222508..15222645 369..506 100 <- Minus
3R 15223081..15223127 1..47 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:39:28 Download gff for IP02321.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11047973..11048172 507..706 100 <- Minus
arm_3R 11048230..11048367 369..506 100 <- Minus
arm_3R 11048425..11048745 48..368 100 <- Minus
arm_3R 11048803..11048849 1..47 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:47:31 Download gff for IP02321.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14963534..14963854 48..368 100 <- Minus
3R 14963912..14963958 1..47 100   Minus
3R 14963082..14963281 507..706 100 <- Minus
3R 14963339..14963476 369..506 100 <- Minus

IP02321.hyp Sequence

Translation from 35 to 556

> IP02321.hyp
MFYHISLEQEILLHPRYFGPQLLETVKQKLYSEVEGTCTGKYGFVIAVTT
IDQIGSGVIQPGQGFVVYPVKYKAIVFRPFKGEVLDAVVKQINKVGMFAE
IGPLSCFISHHSIPADMQFCPNGNPPCYKSKDEDVVISGEDKIRLKIVGT
RVDATGIFAIGTLMDDYLGLVSN*

IP02321.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:48:21
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb7-PA 173 CG31155-PA 1..173 1..173 907 100 Plus

IP02321.pep Sequence

Translation from 35 to 556

> IP02321.pep
MFYHISLEQEILLHPRYFGPQLLETVKQKLYSEVEGTCTGKYGFVIAVTT
IDQIGSGVIQPGQGFVVYPVKYKAIVFRPFKGEVLDAVVKQINKVGMFAE
IGPLSCFISHHSIPADMQFCPNGNPPCYKSKDEDVVISGEDKIRLKIVGT
RVDATGIFAIGTLMDDYLGLVSN*

IP02321.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11824-PA 173 GF11824-PA 1..173 1..173 895 98.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20814-PA 173 GG20814-PA 1..173 1..173 895 98.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18755-PA 173 GH18755-PA 1..173 1..173 889 98.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb7-PA 173 CG31155-PA 1..173 1..173 907 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22645-PA 173 GI22645-PA 1..173 1..173 889 98.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:22:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12210-PA 173 GL12210-PA 1..173 1..173 895 98.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:22:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27654-PA 173 GA27654-PA 1..173 1..173 895 98.8 Plus
Dpse\GA16051-PA 173 GA16051-PA 1..173 1..173 895 98.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:22:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25797-PA 173 GM25797-PA 1..173 1..173 907 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:22:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20374-PA 173 GD20374-PA 1..173 1..173 907 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:22:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23373-PA 173 GJ23373-PA 1..173 1..173 889 98.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:22:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11212-PA 173 GK11212-PA 1..173 1..173 895 98.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:22:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26402-PA 173 GE26402-PA 1..173 1..173 895 98.8 Plus