Clone IP02331 Report

Search the DGRC for IP02331

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:23
Well:31
Vector:pOT2
Associated Gene/TranscriptTotX-RA
Protein status:IP02331.pep: gold
Preliminary Size:603
Sequenced Size:611

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31193 2005-01-01 Successful iPCR screen
TotX 2008-04-29 Release 5.5 accounting
TotX 2008-08-15 Release 5.9 accounting
TotX 2008-12-18 5.12 accounting

Clone Sequence Records

IP02331.complete Sequence

611 bp (611 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023313

> IP02331.complete
CAAGCTATGGGGCTTTCTATTGGCAGCTTGCTAATATGCGTGTTCTTAGG
CATAGTTCCTTTTGCAACTGCTAACACAAACAGTTCAAGTTATGAGGAAC
ACAGGAATTATTTGCTTAACATCTTTCACAATCCATTTGTGAATGACTCC
ATTAAGGAGAAAAATATTCCGCAGCTAATCGCTTTTTATCAACGATATCC
TACAGATGTTCCTCTATCCGACGCAGACAGGCAACAATTTGAAAGGTTTA
TTCATGATTACAGAGAATACCGGGCAGTTTTGGTTGATGGTGCACCACCT
CAAGGAGGATCATTTGGAAACATATTTGGACACTTCCTAGGCAGAGTCGG
AACCCGGTATATTTCGTCTCTGTTTAATAAGAAAAGGGAGGAAAGGAAAT
CCAACCATGCATACATAATCGAGGACTATAACTAAACTTGCCTTTTGTAC
TTTCATGCTATTCATACATTCTGGATCTATACCAATTTGAAGCTTGGAAT
ACTAATGGAAATAATCAGATGTTATTTGTTTGAAAAACTATAAAAATTAA
TCTATAAATAAACTAATCAATACCACTGAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAA

IP02331.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
TotX-RA 603 TotX-RA 25..603 1..579 2895 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16728795..16729372 578..1 2890 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:34:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:16:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20904916..20905494 579..1 2895 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20645747..20646325 579..1 2895 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:16:56 has no hits.

IP02331.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:18:10 Download gff for IP02331.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16728795..16729372 1..578 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:17:22 Download gff for IP02331.complete
Subject Subject Range Query Range Percent Splice Strand
TotX-RA 1..429 7..435 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:53:57 Download gff for IP02331.complete
Subject Subject Range Query Range Percent Splice Strand
TotX-RA 1..429 7..435 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:25:34 Download gff for IP02331.complete
Subject Subject Range Query Range Percent Splice Strand
TotX-RA 1..429 7..435 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:46:27 Download gff for IP02331.complete
Subject Subject Range Query Range Percent Splice Strand
TotX-RA 1..429 7..435 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:29:41 Download gff for IP02331.complete
Subject Subject Range Query Range Percent Splice Strand
TotX-RA 1..429 7..435 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:32:32 Download gff for IP02331.complete
Subject Subject Range Query Range Percent Splice Strand
TotX-RA 25..602 1..578 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:53:57 Download gff for IP02331.complete
Subject Subject Range Query Range Percent Splice Strand
TotX-RA 25..602 1..578 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:25:34 Download gff for IP02331.complete
Subject Subject Range Query Range Percent Splice Strand
TotX-RA 25..602 1..578 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:46:27 Download gff for IP02331.complete
Subject Subject Range Query Range Percent Splice Strand
TotX-RA 25..602 1..578 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:29:41 Download gff for IP02331.complete
Subject Subject Range Query Range Percent Splice Strand
TotX-RA 25..602 1..578 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:18:10 Download gff for IP02331.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20904917..20905494 1..578 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:18:10 Download gff for IP02331.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20904917..20905494 1..578 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:18:10 Download gff for IP02331.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20904917..20905494 1..578 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:25:34 Download gff for IP02331.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16730639..16731216 1..578 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:02 Download gff for IP02331.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20645748..20646325 1..578 100   Minus

IP02331.hyp Sequence

Translation from 0 to 434

> IP02331.hyp
QAMGLSIGSLLICVFLGIVPFATANTNSSSYEEHRNYLLNIFHNPFVNDS
IKEKNIPQLIAFYQRYPTDVPLSDADRQQFERFIHDYREYRAVLVDGAPP
QGGSFGNIFGHFLGRVGTRYISSLFNKKREERKSNHAYIIEDYN*

IP02331.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
TotX-PA 142 CG31193-PA 1..142 3..144 752 100 Plus

IP02331.pep Sequence

Translation from 6 to 434

> IP02331.pep
MGLSIGSLLICVFLGIVPFATANTNSSSYEEHRNYLLNIFHNPFVNDSIK
EKNIPQLIAFYQRYPTDVPLSDADRQQFERFIHDYREYRAVLVDGAPPQG
GSFGNIFGHFLGRVGTRYISSLFNKKREERKSNHAYIIEDYN*

IP02331.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16504-PA 152 GG16504-PA 1..135 1..135 601 84.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:11
Subject Length Description Subject Range Query Range Score Percent Strand
TotX-PA 142 CG31193-PA 1..142 1..142 752 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24287-PA 230 GL24287-PA 123..217 29..123 221 41.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16081-PA 137 GA16081-PA 14..124 8..123 227 35.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15120-PA 150 GM15120-PA 1..135 1..135 657 91.1 Plus
Dsec\GM23148-PA 150 GM23148-PA 1..135 1..135 657 91.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20023-PA 150 GD20023-PA 1..135 1..135 662 91.9 Plus
Dsim\GD23335-PA 131 GD23335-PA 25..122 25..120 143 30.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:22:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11142-PA 150 GE11142-PA 1..135 1..135 596 83 Plus
Dyak\GE25388-PA 131 GE25388-PA 25..130 25..128 138 28.3 Plus