IP02331.complete Sequence
611 bp (611 high quality bases) assembled on 2005-03-01
GenBank Submission: BT023313
> IP02331.complete
CAAGCTATGGGGCTTTCTATTGGCAGCTTGCTAATATGCGTGTTCTTAGG
CATAGTTCCTTTTGCAACTGCTAACACAAACAGTTCAAGTTATGAGGAAC
ACAGGAATTATTTGCTTAACATCTTTCACAATCCATTTGTGAATGACTCC
ATTAAGGAGAAAAATATTCCGCAGCTAATCGCTTTTTATCAACGATATCC
TACAGATGTTCCTCTATCCGACGCAGACAGGCAACAATTTGAAAGGTTTA
TTCATGATTACAGAGAATACCGGGCAGTTTTGGTTGATGGTGCACCACCT
CAAGGAGGATCATTTGGAAACATATTTGGACACTTCCTAGGCAGAGTCGG
AACCCGGTATATTTCGTCTCTGTTTAATAAGAAAAGGGAGGAAAGGAAAT
CCAACCATGCATACATAATCGAGGACTATAACTAAACTTGCCTTTTGTAC
TTTCATGCTATTCATACATTCTGGATCTATACCAATTTGAAGCTTGGAAT
ACTAATGGAAATAATCAGATGTTATTTGTTTGAAAAACTATAAAAATTAA
TCTATAAATAAACTAATCAATACCACTGAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAA
IP02331.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:09:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TotX-RA | 603 | TotX-RA | 25..603 | 1..579 | 2895 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:16:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 16728795..16729372 | 578..1 | 2890 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:34:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:16:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 20904916..20905494 | 579..1 | 2895 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 20645747..20646325 | 579..1 | 2895 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 14:16:56 has no hits.
IP02331.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:18:10 Download gff for
IP02331.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 16728795..16729372 | 1..578 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:17:22 Download gff for
IP02331.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotX-RA | 1..429 | 7..435 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:53:57 Download gff for
IP02331.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotX-RA | 1..429 | 7..435 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:25:34 Download gff for
IP02331.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotX-RA | 1..429 | 7..435 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:46:27 Download gff for
IP02331.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotX-RA | 1..429 | 7..435 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:29:41 Download gff for
IP02331.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotX-RA | 1..429 | 7..435 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:32:32 Download gff for
IP02331.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotX-RA | 25..602 | 1..578 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:53:57 Download gff for
IP02331.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotX-RA | 25..602 | 1..578 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:25:34 Download gff for
IP02331.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotX-RA | 25..602 | 1..578 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:46:27 Download gff for
IP02331.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotX-RA | 25..602 | 1..578 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:29:41 Download gff for
IP02331.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
TotX-RA | 25..602 | 1..578 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:18:10 Download gff for
IP02331.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 20904917..20905494 | 1..578 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:18:10 Download gff for
IP02331.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 20904917..20905494 | 1..578 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:18:10 Download gff for
IP02331.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 20904917..20905494 | 1..578 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:25:34 Download gff for
IP02331.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 16730639..16731216 | 1..578 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:02 Download gff for
IP02331.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 20645748..20646325 | 1..578 | 100 | | Minus |
IP02331.hyp Sequence
Translation from 0 to 434
> IP02331.hyp
QAMGLSIGSLLICVFLGIVPFATANTNSSSYEEHRNYLLNIFHNPFVNDS
IKEKNIPQLIAFYQRYPTDVPLSDADRQQFERFIHDYREYRAVLVDGAPP
QGGSFGNIFGHFLGRVGTRYISSLFNKKREERKSNHAYIIEDYN*
IP02331.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:48:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TotX-PA | 142 | CG31193-PA | 1..142 | 3..144 | 752 | 100 | Plus |
IP02331.pep Sequence
Translation from 6 to 434
> IP02331.pep
MGLSIGSLLICVFLGIVPFATANTNSSSYEEHRNYLLNIFHNPFVNDSIK
EKNIPQLIAFYQRYPTDVPLSDADRQQFERFIHDYREYRAVLVDGAPPQG
GSFGNIFGHFLGRVGTRYISSLFNKKREERKSNHAYIIEDYN*
IP02331.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:22:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG16504-PA | 152 | GG16504-PA | 1..135 | 1..135 | 601 | 84.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TotX-PA | 142 | CG31193-PA | 1..142 | 1..142 | 752 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:22:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL24287-PA | 230 | GL24287-PA | 123..217 | 29..123 | 221 | 41.1 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:22:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA16081-PA | 137 | GA16081-PA | 14..124 | 8..123 | 227 | 35.3 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:22:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM15120-PA | 150 | GM15120-PA | 1..135 | 1..135 | 657 | 91.1 | Plus |
Dsec\GM23148-PA | 150 | GM23148-PA | 1..135 | 1..135 | 657 | 91.1 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:22:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD20023-PA | 150 | GD20023-PA | 1..135 | 1..135 | 662 | 91.9 | Plus |
Dsim\GD23335-PA | 131 | GD23335-PA | 25..122 | 25..120 | 143 | 30.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:22:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE11142-PA | 150 | GE11142-PA | 1..135 | 1..135 | 596 | 83 | Plus |
Dyak\GE25388-PA | 131 | GE25388-PA | 25..130 | 25..128 | 138 | 28.3 | Plus |