Clone IP02458 Report

Search the DGRC for IP02458

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:24
Well:58
Vector:pOT2
Associated Gene/TranscriptmRpS14-RA
Protein status:IP02458.pep: gold
Preliminary Size:387
Sequenced Size:506

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32531 2005-01-01 Successful iPCR screen
mRpS14 2008-04-29 Release 5.5 accounting
mRpS14 2008-08-15 Release 5.9 accounting
mRpS14 2008-12-18 5.12 accounting

Clone Sequence Records

IP02458.complete Sequence

506 bp assembled on 2006-11-09

GenBank Submission: BT023293

> IP02458.complete
AAAGAGGCAAAAAGAAGAAGAGCACCACCGAAAGCAACAACATGAATTCT
CTGGCCAGGATCGGGGGTTTTGTGTGCCAGTCCGTGCAAATAGCCGGCTG
CGGGCTGCAGCAGGTGCGCACAAAGTATGCCGATTGGAAGATGATTCGCG
ACGTAAAGCGGCGCAAGTGCGTCAAGGAGAACGCCGTGGAGCGGCTGCGA
GTCAACTCGCTGCGCAAGAACGACATCCTGCCGCCGGAGCTACGCGAGGT
AGCCGACGCCGAGATCGCTGCTTTTCCTCGGGACTCATCGCTCGTCCGGG
TGAGGGAACGCTGCGCGCTTACGTCACGTCCGCGCGGAGTTGTCCACAAG
TACAGGCTCAGTCGAATCGTGTGGCGCCACCTCGCCGACTACAATAAGCT
GTCCGGCGTCCAGCGCGCCATGTGGTAGCATCTTCTGTTAGCAATCTAGG
GAAATAAACCTTGTTAGTAGTCATCCAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA

IP02458.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS14-RA 744 mRpS14-RA 219..695 1..477 2385 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19368160..19368535 476..104 1800 99.2 Minus
chrX 22417052 chrX 19368595..19368698 104..1 520 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:34:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19479381..19479754 477..104 1870 100 Minus
X 23542271 X 19479814..19479917 104..1 520 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19487479..19487852 477..104 1870 100 Minus
X 23527363 X 19487912..19488015 104..1 520 100 Minus
Blast to na_te.dros performed 2019-03-16 21:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
accord 7404 accord ACCORD 7404bp 1626..1673 1..49 116 73.5 Plus

IP02458.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:36:35 Download gff for IP02458.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19368160..19368534 105..476 99 <- Minus
chrX 19368595..19368698 1..104 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:17:38 Download gff for IP02458.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS14-RA 1..387 42..428 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:44:09 Download gff for IP02458.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS14-RA 1..387 42..428 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:02:39 Download gff for IP02458.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS14-RA 1..387 42..428 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:24:51 Download gff for IP02458.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS14-RA 1..387 42..428 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:25:17 Download gff for IP02458.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS14-RA 1..387 42..428 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:52:05 Download gff for IP02458.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS14-RA 1..387 42..428 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:44:09 Download gff for IP02458.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS14-RA 1..476 1..476 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:02:39 Download gff for IP02458.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS14-RA 1..476 1..476 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:24:52 Download gff for IP02458.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS14-RA 1..387 42..428 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:25:17 Download gff for IP02458.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS14-RA 1..476 1..476 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:36:35 Download gff for IP02458.complete
Subject Subject Range Query Range Percent Splice Strand
X 19479814..19479917 1..104 100   Minus
X 19479382..19479753 105..476 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:36:35 Download gff for IP02458.complete
Subject Subject Range Query Range Percent Splice Strand
X 19479814..19479917 1..104 100   Minus
X 19479382..19479753 105..476 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:36:35 Download gff for IP02458.complete
Subject Subject Range Query Range Percent Splice Strand
X 19479814..19479917 1..104 100   Minus
X 19479382..19479753 105..476 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:02:39 Download gff for IP02458.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19373415..19373786 105..476 100 <- Minus
arm_X 19373847..19373950 1..104 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:57:57 Download gff for IP02458.complete
Subject Subject Range Query Range Percent Splice Strand
X 19487480..19487851 105..476 100 <- Minus
X 19487912..19488015 1..104 100   Minus

IP02458.hyp Sequence

Translation from 2 to 427

> IP02458.hyp
RGKKKKSTTESNNMNSLARIGGFVCQSVQIAGCGLQQVRTKYADWKMIRD
VKRRKCVKENAVERLRVNSLRKNDILPPELREVADAEIAAFPRDSSLVRV
RERCALTSRPRGVVHKYRLSRIVWRHLADYNKLSGVQRAMW*

IP02458.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:49:47
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS14-PB 128 CG32531-PB 1..128 14..141 663 100 Plus
mRpS14-PA 128 CG32531-PA 1..128 14..141 663 100 Plus

IP02458.pep Sequence

Translation from 41 to 427

> IP02458.pep
MNSLARIGGFVCQSVQIAGCGLQQVRTKYADWKMIRDVKRRKCVKENAVE
RLRVNSLRKNDILPPELREVADAEIAAFPRDSSLVRVRERCALTSRPRGV
VHKYRLSRIVWRHLADYNKLSGVQRAMW*

IP02458.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20191-PA 128 GF20191-PA 1..128 1..128 646 96.1 Plus
Dana\GF20159-PA 279 GF20159-PA 1..122 1..128 574 88.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18057-PA 128 GG18057-PA 1..128 1..128 666 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17650-PA 128 GH17650-PA 1..128 1..128 627 93.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:03
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS14-PB 128 CG32531-PB 1..128 1..128 663 100 Plus
mRpS14-PA 128 CG32531-PA 1..128 1..128 663 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16088-PA 128 GI16088-PA 1..128 1..128 615 91.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14528-PA 128 GL14528-PA 1..128 1..128 614 92.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22696-PA 128 GA22696-PA 1..128 1..128 614 92.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22744-PA 128 GM22744-PA 1..128 1..128 666 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15736-PA 128 GJ15736-PA 1..128 1..128 627 93.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15113-PA 128 GK15113-PA 1..128 1..128 621 92.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17389-PA 128 GE17389-PA 1..128 1..128 666 99.2 Plus