BDGP Sequence Production Resources |
Search the DGRC for IP02458
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 24 |
Well: | 58 |
Vector: | pOT2 |
Associated Gene/Transcript | mRpS14-RA |
Protein status: | IP02458.pep: gold |
Preliminary Size: | 387 |
Sequenced Size: | 506 |
Gene | Date | Evidence |
---|---|---|
CG32531 | 2005-01-01 | Successful iPCR screen |
mRpS14 | 2008-04-29 | Release 5.5 accounting |
mRpS14 | 2008-08-15 | Release 5.9 accounting |
mRpS14 | 2008-12-18 | 5.12 accounting |
506 bp assembled on 2006-11-09
GenBank Submission: BT023293
> IP02458.complete AAAGAGGCAAAAAGAAGAAGAGCACCACCGAAAGCAACAACATGAATTCT CTGGCCAGGATCGGGGGTTTTGTGTGCCAGTCCGTGCAAATAGCCGGCTG CGGGCTGCAGCAGGTGCGCACAAAGTATGCCGATTGGAAGATGATTCGCG ACGTAAAGCGGCGCAAGTGCGTCAAGGAGAACGCCGTGGAGCGGCTGCGA GTCAACTCGCTGCGCAAGAACGACATCCTGCCGCCGGAGCTACGCGAGGT AGCCGACGCCGAGATCGCTGCTTTTCCTCGGGACTCATCGCTCGTCCGGG TGAGGGAACGCTGCGCGCTTACGTCACGTCCGCGCGGAGTTGTCCACAAG TACAGGCTCAGTCGAATCGTGTGGCGCCACCTCGCCGACTACAATAAGCT GTCCGGCGTCCAGCGCGCCATGTGGTAGCATCTTCTGTTAGCAATCTAGG GAAATAAACCTTGTTAGTAGTCATCCAAAAAAAAAAAAAAAAAAAAAAAA AAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS14-RA | 744 | mRpS14-RA | 219..695 | 1..477 | 2385 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
accord | 7404 | accord ACCORD 7404bp | 1626..1673 | 1..49 | 116 | 73.5 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 19368160..19368534 | 105..476 | 99 | <- | Minus |
chrX | 19368595..19368698 | 1..104 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS14-RA | 1..387 | 42..428 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS14-RA | 1..387 | 42..428 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS14-RA | 1..387 | 42..428 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS14-RA | 1..387 | 42..428 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS14-RA | 1..387 | 42..428 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS14-RA | 1..387 | 42..428 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS14-RA | 1..476 | 1..476 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS14-RA | 1..476 | 1..476 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS14-RA | 1..387 | 42..428 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS14-RA | 1..476 | 1..476 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19479814..19479917 | 1..104 | 100 | Minus | |
X | 19479382..19479753 | 105..476 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19479814..19479917 | 1..104 | 100 | Minus | |
X | 19479382..19479753 | 105..476 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19479814..19479917 | 1..104 | 100 | Minus | |
X | 19479382..19479753 | 105..476 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 19373415..19373786 | 105..476 | 100 | <- | Minus |
arm_X | 19373847..19373950 | 1..104 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19487480..19487851 | 105..476 | 100 | <- | Minus |
X | 19487912..19488015 | 1..104 | 100 | Minus |
Translation from 2 to 427
> IP02458.hyp RGKKKKSTTESNNMNSLARIGGFVCQSVQIAGCGLQQVRTKYADWKMIRD VKRRKCVKENAVERLRVNSLRKNDILPPELREVADAEIAAFPRDSSLVRV RERCALTSRPRGVVHKYRLSRIVWRHLADYNKLSGVQRAMW*
Translation from 41 to 427
> IP02458.pep MNSLARIGGFVCQSVQIAGCGLQQVRTKYADWKMIRDVKRRKCVKENAVE RLRVNSLRKNDILPPELREVADAEIAAFPRDSSLVRVRERCALTSRPRGV VHKYRLSRIVWRHLADYNKLSGVQRAMW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20191-PA | 128 | GF20191-PA | 1..128 | 1..128 | 646 | 96.1 | Plus |
Dana\GF20159-PA | 279 | GF20159-PA | 1..122 | 1..128 | 574 | 88.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18057-PA | 128 | GG18057-PA | 1..128 | 1..128 | 666 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17650-PA | 128 | GH17650-PA | 1..128 | 1..128 | 627 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS14-PB | 128 | CG32531-PB | 1..128 | 1..128 | 663 | 100 | Plus |
mRpS14-PA | 128 | CG32531-PA | 1..128 | 1..128 | 663 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16088-PA | 128 | GI16088-PA | 1..128 | 1..128 | 615 | 91.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14528-PA | 128 | GL14528-PA | 1..128 | 1..128 | 614 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA22696-PA | 128 | GA22696-PA | 1..128 | 1..128 | 614 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22744-PA | 128 | GM22744-PA | 1..128 | 1..128 | 666 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15736-PA | 128 | GJ15736-PA | 1..128 | 1..128 | 627 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15113-PA | 128 | GK15113-PA | 1..128 | 1..128 | 621 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17389-PA | 128 | GE17389-PA | 1..128 | 1..128 | 666 | 99.2 | Plus |