Clone IP02523 Report

Search the DGRC for IP02523

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:25
Well:23
Vector:pOT2
Associated Gene/TranscriptHsp67Bc-RA
Protein status:IP02523.pep: gold
Preliminary Size:600
Sequenced Size:993

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4190 2005-01-01 Successful iPCR screen
Hsp67Bc 2008-04-29 Release 5.5 accounting
Hsp67Bc 2008-08-15 Release 5.9 accounting
Hsp67Bc 2008-12-18 5.12 accounting

Clone Sequence Records

IP02523.complete Sequence

993 bp (993 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023289

> IP02523.complete
CGGAAAAGTCAAGGTGAATTGTGCGCCAAACTGCAGCTGAGATTGTGGAT
TCCACCACCCGCTGGCAAATCAACCCCTTGGATACTTTTTGAAAGGAAAA
CAGGTCGTCGGTTCAACGAACCTCCTTCCGCCAGATACACAAAGAAGTTA
AGCAAAGAAAAGTAAAATGCCAGATATTCCCTTTGTCTTGAATTTGGACT
CCCCGGACTCCATGTACTACGGCCACGATATGTTCCCGAATCGCATGTAC
AGGCGATTGCATTCGCGGCAGCATCATGATCTTGATTTGCACACCCTGGG
TCTGATTGCCCGGATGGGTGCACATGCCCATCACCTGGTGGCCAATAAAA
GGAACGGAGAGCTGGCTGCATTGAGCCGCGGTGGAGCCTCAAATAAGCAG
GGCAATTTCGAGGTCCATCTGGATGTGGGACTCTTTCAGCCAGGTGAACT
GACCGTCAAACTGGTCAACGAGTGCATTGTGGTCGAGGGAAAACACGAGG
AGCGCGAGGACGATCATGGACATGTATCCCGGCATTTTGTTCGCCGCTAT
CCGCTGCCCAAGGAGTTCGATTCGGATGCCATTGTTTCCACTTTGTCGGA
GGATGGAGTTCTCAATATCACGGTTCCACCATTAGTTTCCAAGGAGGAGC
TCAAGGAGCGCATCATACCCATTAAGCATGTGGGTCCATCGGATCTCTTC
CAGAATGGAAACGGTCATAAGGAGGCCGGTCCGGCAGCTTCTGCTTCAGA
GCCAGAAGCCAAGTGAAGAGCCCCCTCCTAAAGATTGCAGCCTAAGCAGC
CAAGTGATTTCCCAAGACTCTCGTTTATCGTTGCACCAAAAAAAAAAGTC
AAGAAAATATCGCACAAATCGTATTATATTTATTAATTTATTATTAGCTA
CATTTTAAACAGTCCAATCAAATTTTAAGACTAATCGAAATCCAGTATTA
ATAAAGGAATATGAATGTCTCAGTAAAAAAAAAAAAAAAAAAA

IP02523.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:54:11
Subject Length Description Subject Range Query Range Score Percent Strand
Hsp67Bc-RA 600 Hsp67Bc-RA 1..600 167..766 3000 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:43:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9363397..9364369 974..1 4805 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:34:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:43:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9371509..9372483 976..1 4830 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:43:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9364609..9365583 976..1 4840 99.8 Minus
Blast to na_te.dros performed on 2019-03-15 11:43:14 has no hits.

IP02523.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:44:11 Download gff for IP02523.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9363397..9364369 1..974 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:17:50 Download gff for IP02523.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp67Bc-RA 1..600 167..766 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:26:43 Download gff for IP02523.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp67Bc-RA 1..600 167..766 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:32:22 Download gff for IP02523.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp67Bc-RA 1..600 167..766 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:10:48 Download gff for IP02523.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp67Bc-RA 1..600 167..766 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:41:01 Download gff for IP02523.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp67Bc-RA 1..600 167..766 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:29:41 Download gff for IP02523.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp67Bc-RA 1..600 167..766 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:26:43 Download gff for IP02523.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp67Bc-RA 1..973 1..974 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:32:22 Download gff for IP02523.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp67Bc-RA 15..987 1..974 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:10:48 Download gff for IP02523.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp67Bc-RA 1..600 167..766 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:41:01 Download gff for IP02523.complete
Subject Subject Range Query Range Percent Splice Strand
Hsp67Bc-RA 15..987 1..974 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:44:11 Download gff for IP02523.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9371511..9372483 1..974 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:44:11 Download gff for IP02523.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9371511..9372483 1..974 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:44:11 Download gff for IP02523.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9371511..9372483 1..974 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:32:22 Download gff for IP02523.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9364611..9365583 1..974 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:47:17 Download gff for IP02523.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9364611..9365583 1..974 99   Minus

IP02523.pep Sequence

Translation from 166 to 765

> IP02523.pep
MPDIPFVLNLDSPDSMYYGHDMFPNRMYRRLHSRQHHDLDLHTLGLIARM
GAHAHHLVANKRNGELAALSRGGASNKQGNFEVHLDVGLFQPGELTVKLV
NECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVSTLSEDGVLN
ITVPPLVSKEELKERIIPIKHVGPSDLFQNGNGHKEAGPAASASEPEAK*

IP02523.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23740-PA 195 GF23740-PA 1..195 1..195 875 85.1 Plus
Dana\GF23739-PA 205 GF23739-PA 7..205 4..199 313 36.9 Plus
Dana\GF10691-PA 190 GF10691-PA 71..181 81..188 285 50.5 Plus
Dana\GF10692-PA 219 GF10692-PA 69..192 53..177 259 49.6 Plus
Dana\GF11829-PA 187 GF11829-PA 79..173 81..175 250 49.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14048-PA 199 GG14048-PA 1..199 1..199 1013 96.5 Plus
Dere\GG14047-PA 208 GG14047-PA 89..203 81..194 289 47.8 Plus
Dere\GG15370-PA 187 GG15370-PA 72..169 81..177 273 53.1 Plus
Dere\GG15371-PA 212 GG15371-PA 62..203 49..188 271 49.7 Plus
Dere\GG20009-PA 187 GG20009-PA 78..173 80..175 250 47.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16985-PA 195 GH16985-PA 1..187 1..186 739 73.9 Plus
Dgri\GH14700-PA 204 GH14700-PA 57..198 52..194 319 45.9 Plus
Dgri\GH23707-PA 185 GH23707-PA 72..178 81..186 299 53.3 Plus
Dgri\GH16863-PA 185 GH16863-PA 72..178 81..186 299 53.3 Plus
Dgri\GH17009-PA 218 GH17009-PA 65..191 53..177 299 47 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:21
Subject Length Description Subject Range Query Range Score Percent Strand
Hsp67Bc-PA 199 CG4190-PA 1..199 1..199 1055 100 Plus
Hsp27-PB 213 CG4466-PB 34..204 18..188 308 42.3 Plus
Hsp27-PA 213 CG4466-PA 34..204 18..188 308 42.3 Plus
Hsp26-PB 208 CG4183-PB 89..208 81..199 288 47.5 Plus
Hsp26-PA 208 CG4183-PA 89..208 81..199 288 47.5 Plus
Hsp23-PB 186 CG4463-PB 55..168 67..177 275 50 Plus
Hsp23-PA 186 CG4463-PA 55..168 67..177 275 50 Plus
l(2)efl-PC 187 CG4533-PC 79..178 81..180 246 47 Plus
l(2)efl-PA 187 CG4533-PA 79..178 81..180 246 47 Plus
Hsp67Ba-PA 445 CG4167-PA 109..222 63..172 243 42.1 Plus
CG7409-PA 154 CG7409-PA 58..150 81..177 196 41.2 Plus
Hsp22-PB 174 CG4460-PB 60..157 76..173 184 46.5 Plus
Hsp22-PA 174 CG4460-PA 60..157 76..173 184 46.5 Plus
CG4461-PA 200 CG4461-PA 98..173 81..155 169 38.2 Plus
CG13133-PA 217 CG13133-PA 35..181 29..173 153 34.8 Plus
CG14207-PC 154 CG14207-PC 67..153 82..171 139 36.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13089-PA 193 GI13089-PA 1..187 1..187 720 71.8 Plus
Dmoj\GI12247-PA 211 GI12247-PA 60..190 57..177 308 47.3 Plus
Dmoj\GI13087-PA 209 GI13087-PA 62..201 54..188 302 45.4 Plus
Dmoj\GI13085-PA 185 GI13085-PA 54..185 61..195 291 42.6 Plus
Dmoj\GI13088-PA 212 GI13088-PA 58..187 57..177 274 49.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22633-PA 196 GL22633-PA 1..196 1..199 863 83.5 Plus
Dper\GL22632-PA 204 GL22632-PA 27..193 50..188 295 39.9 Plus
Dper\GL22446-PA 184 GL22446-PA 71..168 81..177 279 51 Plus
Dper\GL22443-PA 184 GL22443-PA 71..168 81..177 279 51 Plus
Dper\GL22447-PA 225 GL22447-PA 71..195 52..177 260 48.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24923-PA 196 GA24923-PA 1..196 1..199 860 83.5 Plus
Dpse\GA18011-PA 204 GA18011-PA 27..193 50..188 295 39.9 Plus
Dpse\GA18202-PA 184 GA18202-PA 54..168 69..177 277 47 Plus
Dpse\GA18205-PA 225 GA18205-PA 71..195 52..177 260 48.5 Plus
Dpse\GA28726-PA 144 GA28726-PA 17..114 81..177 252 58.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24882-PA 199 GM24882-PA 1..199 1..199 1024 98 Plus
Dsec\GM24881-PA 211 GM24881-PA 89..197 81..188 289 50.5 Plus
Dsec\GM25142-PA 183 GM25142-PA 45..165 60..177 275 47.9 Plus
Dsec\GM25143-PA 213 GM25143-PA 49..204 43..188 264 45.4 Plus
Dsec\GM15521-PA 187 GM15521-PA 78..173 80..175 250 47.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12934-PA 199 GD12934-PA 1..199 1..199 1032 98.5 Plus
Dsim\GD12933-PA 211 GD12933-PA 89..197 81..188 289 50.5 Plus
Dsim\GD14177-PA 213 GD14177-PA 90..204 81..188 256 53 Plus
Dsim\GD25025-PA 187 GD25025-PA 78..173 80..175 250 47.9 Plus
Dsim\GD14176-PA 177 GD14176-PA 71..159 81..177 241 51 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13837-PA 193 GJ13837-PA 1..186 1..186 745 74.9 Plus
Dvir\GJ11479-PA 216 GJ11479-PA 57..189 54..177 317 48.1 Plus
Dvir\GJ13836-PA 214 GJ13836-PA 56..188 54..177 311 48.9 Plus
Dvir\GJ13835-PA 211 GJ13835-PA 64..186 55..177 303 50 Plus
Dvir\GJ13834-PA 186 GJ13834-PA 58..177 70..186 297 49.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19253-PA 192 GK19253-PA 1..179 1..180 800 80.7 Plus
Dwil\GK17636-PA 186 GK17636-PA 60..177 67..187 295 49.2 Plus
Dwil\GK16566-PA 216 GK16566-PA 55..191 47..177 285 47.4 Plus
Dwil\GK23172-PA 187 GK23172-PA 79..173 81..175 263 50.5 Plus
Dwil\GK17637-PA 227 GK17637-PA 86..195 62..177 252 50.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Hsp67Bc-PA 199 GE21251-PA 1..199 1..199 1022 97.5 Plus
Dyak\GE21250-PA 208 GE21250-PA 89..203 81..194 291 47.8 Plus
Dyak\GE20832-PA 186 GE20832-PA 71..168 81..177 273 53.1 Plus
Dyak\GE20833-PA 212 GE20833-PA 62..203 49..188 272 49.7 Plus
Dyak\GE11545-PA 187 GE11545-PA 78..173 80..175 251 47.9 Plus

IP02523.hyp Sequence

Translation from 166 to 765

> IP02523.hyp
MPDIPFVLNLDSPDSMYYGHDMFPNRMYRRLHSRQHHDLDLHTLGLIARM
GAHAHHLVANKRNGELAALSRGGASNKQGNFEVHLDVGLFQPGELTVKLV
NECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVSTLSEDGVLN
ITVPPLVSKEELKERIIPIKHVGPSDLFQNGNGHKEAGPAASASEPEAK*

IP02523.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
Hsp67Bc-PA 199 CG4190-PA 1..199 1..199 1055 100 Plus
Hsp27-PB 213 CG4466-PB 34..204 18..188 308 42.3 Plus
Hsp27-PA 213 CG4466-PA 34..204 18..188 308 42.3 Plus
Hsp26-PB 208 CG4183-PB 89..208 81..199 288 47.5 Plus
Hsp26-PA 208 CG4183-PA 89..208 81..199 288 47.5 Plus