Clone IP02527 Report

Search the DGRC for IP02527

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:25
Well:27
Vector:pOT2
Associated Gene/TranscriptMtnB-RA
Protein status:IP02527.pep: gold
Preliminary Size:301
Sequenced Size:353

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4312 2005-01-01 Successful iPCR screen
MtnB 2008-04-29 Release 5.5 accounting
MtnB 2008-08-15 Release 5.9 accounting
MtnB 2008-12-18 5.12 accounting

Clone Sequence Records

IP02527.complete Sequence

353 bp (353 high quality bases) assembled on 2006-05-24

GenBank Submission: BT025813

> IP02527.complete
CCAAGCAACAAGCAAACAAGTGAATATCAGTTCGCCTCAGCCAAGTGAAA
GTCGAGAAATAGATACATACAAGATGGTTTGCAAGGGTTGTGGAACAAAC
TGCCAGTGCTCGGCCCAAAAGTGCGGGGACAACTGCGCCTGCAACAAGGA
TTGCCAGTGCGTTTGCAAGAATGGGCCCAAGGACCAGTGCTGCAGCAACA
AATAAGCGGGCCAACTATATAACTAACTGTTTAACTTCTAAACTGGAGCT
TAACTCCCAACGAGTTGGCCGCAATAAATAAAGTTTATAAAGATTTTGAG
CATTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

IP02527.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:49:32
Subject Length Description Subject Range Query Range Score Percent Strand
MtnB-RA 584 MtnB-RA 144..452 1..309 1545 100 Plus
MtnD.b 590 MtnD.b 88..212 69..193 340 84.8 Plus
MtnD-RA 646 MtnD-RA 144..268 69..193 340 84.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16327172..16327382 305..95 1040 99.5 Minus
chr3R 27901430 chr3R 16327440..16327537 98..1 490 100 Minus
chr3R 27901430 chr3R 16359022..16359116 99..193 235 83.2 Plus
chr3R 27901430 chr3R 16184403..16184478 119..194 200 84.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:34:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:14:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20503234..20503448 309..95 1060 99.5 Minus
3R 32079331 3R 20503506..20503603 98..1 490 100 Minus
3R 32079331 3R 20535108..20535202 99..193 235 83.2 Plus
3R 32079331 3R 20360450..20360525 119..194 200 84.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20244065..20244279 309..95 1060 99.5 Minus
3R 31820162 3R 20244337..20244434 98..1 490 100 Minus
3R 31820162 3R 20275939..20276033 99..193 235 83.1 Plus
3R 31820162 3R 20101281..20101356 119..194 200 84.2 Plus
Blast to na_te.dros performed on 2019-03-16 06:14:41 has no hits.

IP02527.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:15:29 Download gff for IP02527.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16327172..16327378 99..305 100 <- Minus
chr3R 16327440..16327537 1..98 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:17:51 Download gff for IP02527.complete
Subject Subject Range Query Range Percent Splice Strand
MtnB-RA 1..132 74..205 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:44:38 Download gff for IP02527.complete
Subject Subject Range Query Range Percent Splice Strand
MtnB-RA 1..132 74..205 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:26:18 Download gff for IP02527.complete
Subject Subject Range Query Range Percent Splice Strand
MtnB-RA 1..132 74..205 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:25:32 Download gff for IP02527.complete
Subject Subject Range Query Range Percent Splice Strand
MtnB-RA 1..132 74..205 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:19:04 Download gff for IP02527.complete
Subject Subject Range Query Range Percent Splice Strand
MtnB-RA 1..132 74..205 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:52:53 Download gff for IP02527.complete
Subject Subject Range Query Range Percent Splice Strand
MtnB-RA 1..301 5..305 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:44:38 Download gff for IP02527.complete
Subject Subject Range Query Range Percent Splice Strand
MtnB-RA 1..301 5..305 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:26:18 Download gff for IP02527.complete
Subject Subject Range Query Range Percent Splice Strand
MtnB-RA 16..320 1..305 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:25:32 Download gff for IP02527.complete
Subject Subject Range Query Range Percent Splice Strand
MtnB-RA 1..301 5..305 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:19:04 Download gff for IP02527.complete
Subject Subject Range Query Range Percent Splice Strand
MtnB-RA 16..320 1..305 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:15:29 Download gff for IP02527.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20503238..20503444 99..305 100 <- Minus
3R 20503506..20503603 1..98 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:15:29 Download gff for IP02527.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20503238..20503444 99..305 100 <- Minus
3R 20503506..20503603 1..98 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:15:29 Download gff for IP02527.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20503238..20503444 99..305 100 <- Minus
3R 20503506..20503603 1..98 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:26:18 Download gff for IP02527.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16328960..16329166 99..305 100 <- Minus
arm_3R 16329228..16329325 1..98 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:58:30 Download gff for IP02527.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20244337..20244434 1..98 100   Minus
3R 20244069..20244275 99..305 100 <- Minus

IP02527.hyp Sequence

Translation from 0 to 204

> IP02527.hyp
QATSKQVNISSPQPSESREIDTYKMVCKGCGTNCQCSAQKCGDNCACNKD
CQCVCKNGPKDQCCSNK*

IP02527.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
MtnB-PC 43 CG4312-PC 1..43 25..67 271 100 Plus
MtnB-PB 43 CG4312-PB 1..43 25..67 271 100 Plus
MtnB-PA 43 CG4312-PA 1..43 25..67 271 100 Plus
MtnC-PA 43 CG5097-PA 1..43 25..67 234 81.4 Plus
MtnD-PB 44 CG33192-PB 1..43 25..67 221 79.1 Plus

IP02527.pep Sequence

Translation from 73 to 204

> IP02527.pep
MVCKGCGTNCQCSAQKCGDNCACNKDCQCVCKNGPKDQCCSNK*

IP02527.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23027-PA 43 GF23027-PA 1..43 1..43 158 76.7 Plus
Dana\GF23030-PA 45 GF23030-PA 1..43 1..43 152 74.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\MtnB-PA 43 GG15446-PA 1..43 1..43 197 100 Plus
Dere\MtnC-PA 43 GG23900-PA 1..43 1..43 163 81.4 Plus
Dere\MtnD-PA 46 GG23934-PA 1..43 1..43 155 79.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14155-PA 44 GH14155-PA 1..43 1..43 165 81.4 Plus
Dgri\GH14169-PA 38 GH14169-PA 1..38 6..43 127 73.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
MtnB-PC 43 CG4312-PC 1..43 1..43 271 100 Plus
MtnB-PB 43 CG4312-PB 1..43 1..43 271 100 Plus
MtnB-PA 43 CG4312-PA 1..43 1..43 271 100 Plus
MtnC-PA 43 CG5097-PA 1..43 1..43 234 81.4 Plus
MtnD-PB 44 CG33192-PB 1..43 1..43 221 79.1 Plus
MtnE-PA 41 CG42872-PA 1..41 1..43 160 65.1 Plus
MtnE-PB 41 CG42872-PB 1..41 1..43 160 65.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22231-PA 45 GI22231-PA 1..43 1..43 156 76.7 Plus
Dmoj\GI22235-PA 44 GI22235-PA 1..43 1..43 140 72.1 Plus
Dmoj\GI10540-PA 43 GI10540-PA 1..43 1..43 128 67.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24090-PA 43 GL24090-PA 1..43 1..43 173 86 Plus
Dper\GL23469-PA 44 GL23469-PA 1..43 1..43 156 79.1 Plus
Dper\GL23465-PA 45 GL23465-PA 1..43 1..43 154 69.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\MtnB-PA 43 GA26502-PA 1..43 1..43 176 88.4 Plus
Dpse\MtnC-PA 45 GA27265-PA 1..43 1..43 161 74.4 Plus
Dpse\MtnD-PA 44 GA27268-PA 1..43 1..43 156 79.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\MtnB-PA 43 GM23190-PA 1..43 1..43 197 100 Plus
Dsec\MtnC-PA 43 GM23109-PA 1..43 1..43 163 81.4 Plus
Dsec\MtnD-PA 44 GM23116-PA 1..43 1..43 154 79.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\MtnB-PA 43 GD20063-PA 1..43 1..43 197 100 Plus
Dsim\MtnC-PA 43 GD15139-PA 1..43 1..43 163 81.4 Plus
Dsim\MtnD-PA 44 GD19355-PA 1..43 1..43 154 79.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\MtnB-PA 43 GJ24195-PA 1..43 1..43 164 81.4 Plus
Dvir\MtnC-PA 47 GJ23034-PA 1..43 1..43 154 74.4 Plus
Dvir\MtnD-PA 44 GJ23040-PA 1..43 1..43 147 74.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19117-PA 43 GK19117-PA 1..43 1..43 176 88.4 Plus
Dwil\GK22728-PA 43 GK22728-PA 1..43 1..43 170 86 Plus
Dwil\GK22725-PA 43 GK22725-PA 1..43 1..43 168 86 Plus
Dwil\GK22451-PA 45 GK22451-PA 1..43 1..43 158 79.1 Plus
Dwil\GK22447-PA 45 GK22447-PA 1..43 1..43 153 74.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\MtnC-PA 43 GE25073-PA 1..42 1..42 190 97.6 Plus
Dyak\MtnB-PA 43 GE25072-PA 1..42 1..42 190 97.6 Plus
Dyak\MtnD-PA 46 GE25666-PA 1..43 1..43 150 76.7 Plus