BDGP Sequence Production Resources |
Search the DGRC for IP02530
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 25 |
Well: | 30 |
Vector: | pOT2 |
Associated Gene/Transcript | rpr-RA |
Protein status: | IP02530.pep: gold |
Preliminary Size: | 851 |
Sequenced Size: | 934 |
Gene | Date | Evidence |
---|---|---|
CG4319 | 2005-01-01 | Successful iPCR screen |
rpr | 2008-04-29 | Release 5.5 accounting |
rpr | 2008-08-15 | Release 5.9 accounting |
rpr | 2008-12-18 | 5.12 accounting |
934 bp (934 high quality bases) assembled on 2005-03-01
GenBank Submission: BT023284
> IP02530.complete CCATCGCAGCGAACGCATCTCGAAAAAGTCATTGAATAAGAGAGACACCA GAACAAAGTGAACGAACTCGAAAATACGAAAGCAAAGTGTGTGCGCCAGC AACAAAGAACTAACTCGATAAATATTCATTGTGCAGAAGAGAAAGTTATT GAGTCACTACCAGTTGTGTAATTCCGAACCAGAAGAAAGATAAACCAACA ATGGCAGTGGCATTCTACATACCCGATCAGGCGACTCTGTTGCGGGAGGC GGAGCAGAAGGAGCAGCAGATCCTTCGCTTGCGGGAGTCACAGTGGAGAT TCCTGGCCACCGTCGTCCTGGAAACCCTGCGCCAGTACACTTCATGTCAT CCGAAGACCGGAAGAAAGTCCGGCAAATATCGCAAGCCATCGCAATGAGG ATTCGAGTAACTAACGAATACGGGGAAAACCAATAGTCCAGTCCAAAATC CAGAGTACAAAGGAAATAAGCATGAGCCAACCCAAAACCCAAAACAGTCA CCACTCATCAGCCGACGGCACTCGATTTCTACTGCAGTCAAGGACACAGA GCCACAACACCCACCCAATTTTAGTTTACTCATCAAAGCGATTGTGATAA TGGTTTTGTTTCTACAAAAAAGCGGAGGAAAAATTTGAAAAAAATAACGT TTTTATAAAGTCCCCAATTTTTTACAAAAATGTTTTAATGATATAAATCA ACTTTTTTAGAAATAATTTACTCTTAAAGCCTATTTAAATGAATTACTAC TGTAATAGTTTGTAAGTTCTTTTGTAAGACGAGTTTTTCTAAGTTTTTTT TAAGAAGAAACCCCAGAAAAAAACGAAGATGAGTCGAAGTTGGCTAAAAA TTGCATCAATTTTTTGTCAAACAAAAAGTCAATAAAACAAAAACGAAAAC TAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
rpr-RA | 851 | rpr-RA | 1..851 | 33..883 | 4120 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 18387157..18388059 | 901..1 | 4205 | 98.7 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 18397528..18398435 | 908..1 | 4355 | 99.1 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 18390628..18391535 | 908..1 | 4375 | 99.1 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 18387178..18388059 | 1..880 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
rpr-RA | 1..198 | 201..398 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
rpr-RA | 1..198 | 201..398 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
rpr-RA | 1..198 | 201..398 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
rpr-RA | 1..198 | 201..398 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
rpr-RA | 1..198 | 201..398 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
rpr-RA | 1..848 | 33..880 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
rpr-RA | 1..848 | 33..880 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
rpr-RA | 1..880 | 1..880 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
rpr-RA | 1..848 | 33..880 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
rpr-RA | 1..880 | 1..880 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18397556..18398435 | 1..880 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18397556..18398435 | 1..880 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18397556..18398435 | 1..880 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 18390656..18391535 | 1..880 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18390656..18391535 | 1..880 | 99 | Minus |
Translation from 200 to 397
> IP02530.hyp MAVAFYIPDQATLLREAEQKEQQILRLRESQWRFLATVVLETLRQYTSCH PKTGRKSGKYRKPSQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
rpr-PA | 65 | CG4319-PA | 1..65 | 1..65 | 334 | 100 | Plus |
Translation from 200 to 397
> IP02530.pep MAVAFYIPDQATLLREAEQKEQQILRLRESQWRFLATVVLETLRQYTSCH PKTGRKSGKYRKPSQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10821-PA | 65 | GF10821-PA | 1..65 | 1..65 | 303 | 87.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15745-PA | 65 | GG15745-PA | 1..65 | 1..65 | 321 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17114-PA | 67 | GH17114-PA | 1..67 | 1..65 | 177 | 57.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
rpr-PA | 65 | CG4319-PA | 1..65 | 1..65 | 334 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11719-PA | 67 | GI11719-PA | 1..67 | 1..65 | 181 | 57.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22708-PA | 72 | GL22708-PA | 1..72 | 1..65 | 255 | 72.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18104-PA | 72 | GA18104-PA | 1..72 | 1..65 | 255 | 72.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14944-PA | 65 | GM14944-PA | 1..65 | 1..65 | 324 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12346-PA | 65 | GD12346-PA | 1..65 | 1..65 | 328 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11393-PA | 67 | GJ11393-PA | 1..67 | 1..65 | 183 | 57.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19143-PA | 70 | GK19143-PA | 1..70 | 1..65 | 266 | 75.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE22077-PA | 65 | GE22077-PA | 1..65 | 1..65 | 318 | 92.3 | Plus |