Clone IP02534 Report

Search the DGRC for IP02534

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:25
Well:34
Vector:pOT2
Associated Gene/TranscriptGstD7-RA
Protein status:IP02534.pep: gold
Preliminary Size:675
Sequenced Size:736

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4371 2005-01-01 Successful iPCR screen
GstD7 2008-04-29 Release 5.5 accounting
GstD7 2008-08-15 Release 5.9 accounting
GstD7 2008-12-18 5.12 accounting

Clone Sequence Records

IP02534.complete Sequence

736 bp (736 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023285

> IP02534.complete
AGTCACAATGCCGAACTTGGATCTCTACAATTTCCCCATGGCGCCGGCCA
GTCGCGCCATCCAGATGGTGGCCAAGGCTTTGGGTCTGGAGCTGAACTCC
AAGTTGATCAACACGATGGAGGGTGACCAACTGAAGCCAGAGTTCGTGAG
GATTAACCCACAGCACACCATTCCCACGCTGGTGGACAATGGATTTGTCA
TCTGGGAGTCGCGTGCCATCGCCGTCTATCTGGTGGAGAAGTACGGCAAA
CCCGATTCCCCACTCTATCCCAACGATCCCCAGAAGCGGGCTTTGATCAA
CCAGAGGCTTTACTTCGATATGGGCACCCTGTACGACGCCCTGACCAAAT
ACTTCTTCCTAATCTTCCGCACTGGCAAATTCGGAGATCAGGAAGCTCTG
GACAAGGTTAACTCCGCCTTTGGATTCCTCAACACCTTCCTGGAGGGTCA
GGACTTCGTGGCCGGTAGCCAACTGACCGTGGCTGATATCGTCATCCTGG
CCACCGTATCCACCGTAGAATGGTTTTCGTTTGACCTAAGCAAGTTCCCC
AACGTGGAGAGGTGGCTTAAGAATGCCCCAAAAGTAACTCCTGGATGGGA
GCAAAATCTTGAGAGTCTGCAGCAGGGAAAGAAGTTCCTGCAGGACCTTC
AAGCGGCAAAGGAAAAGGAAGTAAAGGCCTAAACTATTTTAAATAAATAA
AAACCTGAGTCTAATCTAAAAAAAAAAAAAAAAAAA

IP02534.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:54:13
Subject Length Description Subject Range Query Range Score Percent Strand
GstD7-RA 717 GstD7-RA 1..717 1..717 3585 100 Plus
GstD2-RA 734 GstD2-RA 76..260 65..249 535 85.9 Plus
GstD4-RA 723 GstD4-RA 169..284 134..249 370 87.9 Plus
GstD2-RA 734 GstD2-RA 422..521 414..513 200 80 Plus
GstD2-RA 734 GstD2-RA 277..344 269..336 190 85.2 Plus
GstD4-RA 723 GstD4-RA 300..363 268..331 170 84.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:01:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8203921..8204637 1..717 3570 99.9 Plus
chr3R 27901430 chr3R 8197423..8197868 65..513 665 77.1 Plus
chr3R 27901430 chr3R 8199656..8200064 134..545 525 75.7 Plus
chr3R 27901430 chr3R 8202657..8203133 121..600 505 74.2 Plus
chr3R 27901430 chr3R 8201290..8201690 162..565 440 74.5 Plus
chr3R 27901430 chr3R 8205517..8205730 116..332 375 79.3 Plus
chr3R 27901430 chr3R 8193631..8193891 334..71 370 76.9 Minus
chr3R 27901430 chr3R 8198516..8198772 64..323 290 75 Plus
chr3R 27901430 chr3R 8190606..8190775 333..161 200 75.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:34:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:01:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12378539..12379257 1..719 3595 100 Plus
3R 32079331 3R 12372046..12372491 65..513 665 77.1 Plus
3R 32079331 3R 12375812..12376309 65..565 535 74.3 Plus
3R 32079331 3R 12374270..12374678 134..545 525 75.7 Plus
3R 32079331 3R 12377276..12377752 121..600 505 74.2 Plus
3R 32079331 3R 12380135..12380348 116..332 375 79.3 Plus
3R 32079331 3R 12368254..12368514 334..71 370 76.9 Minus
3R 32079331 3R 12373129..12373385 64..323 290 75 Plus
3R 32079331 3R 12365229..12365398 333..161 200 75.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:43:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12119370..12120088 1..719 3595 100 Plus
3R 31820162 3R 12112877..12113061 65..249 535 85.9 Plus
3R 31820162 3R 12116710..12116827 132..249 380 88.1 Plus
3R 31820162 3R 12115101..12115216 134..249 370 87.9 Plus
3R 31820162 3R 12109156..12109345 260..71 350 78.9 Minus
3R 31820162 3R 12114003..12114142 107..246 265 79.2 Plus
3R 31820162 3R 12120966..12121069 116..219 235 81.7 Plus
3R 31820162 3R 12118258..12118376 275..393 220 78.9 Plus
3R 31820162 3R 12121113..12121179 266..332 215 88 Plus
3R 31820162 3R 12118107..12118232 121..246 210 77.7 Plus
3R 31820162 3R 12113223..12113322 414..513 200 80 Plus
3R 31820162 3R 12117011..12117088 436..513 195 83.3 Plus
3R 31820162 3R 12113078..12113145 269..336 190 85.2 Plus
3R 31820162 3R 12106141..12106229 249..161 190 80.8 Minus
3R 31820162 3R 12115232..12115295 268..331 170 84.3 Plus
3R 31820162 3R 12114318..12114355 425..462 145 92.1 Plus
3R 31820162 3R 12108953..12109005 466..414 145 84.9 Minus
Blast to na_te.dros performed 2019-03-16 17:01:37
Subject Length Description Subject Range Query Range Score Percent Strand
F-element 4708 F-element F 4708bp 1073..1126 649..702 108 66.7 Plus

IP02534.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:02:54 Download gff for IP02534.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8203921..8204637 1..717 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:17:54 Download gff for IP02534.complete
Subject Subject Range Query Range Percent Splice Strand
GstD7-RA 1..675 8..682 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:26:46 Download gff for IP02534.complete
Subject Subject Range Query Range Percent Splice Strand
GstD7-RA 1..675 8..682 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:50:23 Download gff for IP02534.complete
Subject Subject Range Query Range Percent Splice Strand
GstD7-RA 1..675 8..682 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:10:50 Download gff for IP02534.complete
Subject Subject Range Query Range Percent Splice Strand
GstD7-RA 1..675 8..682 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:49:04 Download gff for IP02534.complete
Subject Subject Range Query Range Percent Splice Strand
GstD7-RA 1..675 8..682 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:29:44 Download gff for IP02534.complete
Subject Subject Range Query Range Percent Splice Strand
GstD7-RA 1..675 8..682 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:26:45 Download gff for IP02534.complete
Subject Subject Range Query Range Percent Splice Strand
GstD7-RA 1..717 1..717 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:50:23 Download gff for IP02534.complete
Subject Subject Range Query Range Percent Splice Strand
GstD7-RA 1..717 1..717 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:10:50 Download gff for IP02534.complete
Subject Subject Range Query Range Percent Splice Strand
GstD7-RA 1..675 8..682 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:49:04 Download gff for IP02534.complete
Subject Subject Range Query Range Percent Splice Strand
GstD7-RA 40..756 1..717 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:02:54 Download gff for IP02534.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12378539..12379255 1..717 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:02:54 Download gff for IP02534.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12378539..12379255 1..717 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:02:54 Download gff for IP02534.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12378539..12379255 1..717 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:50:23 Download gff for IP02534.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8204261..8204977 1..717 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:47:20 Download gff for IP02534.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12119370..12120086 1..717 100   Plus

IP02534.hyp Sequence

Translation from 0 to 681

> IP02534.hyp
VTMPNLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVR
INPQHTIPTLVDNGFVIWESRAIAVYLVEKYGKPDSPLYPNDPQKRALIN
QRLYFDMGTLYDALTKYFFLIFRTGKFGDQEALDKVNSAFGFLNTFLEGQ
DFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVERWLKNAPKVTPGWE
QNLESLQQGKKFLQDLQAAKEKEVKA*

IP02534.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
GstD7-PA 224 CG4371-PA 1..224 3..226 1162 100 Plus
GstD6-PA 215 CG4423-PA 1..209 6..215 760 68.6 Plus
GstD2-PA 215 CG4181-PA 1..204 6..210 729 68.3 Plus
GstD4-PA 215 CG11512-PA 1..213 6..219 714 64.5 Plus
GstD5-PA 216 CG12242-PA 1..216 6..222 711 62.7 Plus

IP02534.pep Sequence

Translation from 7 to 681

> IP02534.pep
MPNLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRIN
PQHTIPTLVDNGFVIWESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQR
LYFDMGTLYDALTKYFFLIFRTGKFGDQEALDKVNSAFGFLNTFLEGQDF
VAGSQLTVADIVILATVSTVEWFSFDLSKFPNVERWLKNAPKVTPGWEQN
LESLQQGKKFLQDLQAAKEKEVKA*

IP02534.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17946-PA 220 GF17946-PA 1..220 1..220 949 79.5 Plus
Dana\GF17945-PA 219 GF17945-PA 1..212 1..213 893 76.5 Plus
Dana\GF17944-PA 219 GF17944-PA 1..210 4..212 828 71.9 Plus
Dana\GF17943-PA 218 GF17943-PA 1..217 4..220 698 61 Plus
Dana\GF17947-PA 214 GF17947-PA 1..208 4..212 652 57.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18795-PA 224 GG18795-PA 1..224 1..224 1082 90.6 Plus
Dere\GG18761-PA 215 GG18761-PA 1..204 4..208 757 70.2 Plus
Dere\GG18783-PA 216 GG18783-PA 1..216 4..219 724 63.1 Plus
Dere\GG18772-PA 215 GG18772-PA 1..196 4..200 671 61.9 Plus
Dere\GG18806-PA 212 GG18806-PA 1..209 4..213 659 57.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:21:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20548-PA 213 GH20548-PA 1..211 4..215 666 59.9 Plus
Dgri\GH17520-PA 213 GH17520-PA 1..211 4..215 666 59.9 Plus
Dgri\GH20186-PA 209 GH20186-PA 3..209 5..212 648 58.2 Plus
Dgri\GH13103-PA 209 GH13103-PA 3..209 5..212 644 57.7 Plus
Dgri\GH17521-PA 216 GH17521-PA 1..207 4..211 642 57.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
GstD7-PA 224 CG4371-PA 1..224 1..224 1162 100 Plus
GstD6-PA 215 CG4423-PA 1..209 4..213 760 68.6 Plus
GstD2-PA 215 CG4181-PA 1..204 4..208 729 68.3 Plus
GstD4-PA 215 CG11512-PA 1..213 4..217 714 64.5 Plus
GstD5-PA 216 CG12242-PA 1..216 4..220 711 62.7 Plus
GstD8-PA 212 CG4421-PA 1..209 4..213 643 57.1 Plus
GstD1-PB 209 CG10045-PB 2..209 4..212 642 58.9 Plus
GstD1-PA 209 CG10045-PA 2..209 4..212 642 58.9 Plus
GstD3-PA 199 CG4381-PA 1..197 20..217 640 60.6 Plus
GstD10-PB 210 CG18548-PB 1..210 4..213 565 52.6 Plus
GstD10-PA 210 CG18548-PA 1..210 4..213 565 52.6 Plus
GstD9-PB 218 CG10091-PB 2..208 4..209 556 53.4 Plus
GstD9-PA 218 CG10091-PA 2..208 4..209 556 53.4 Plus
GstD11-PA 222 CG17639-PA 6..186 6..187 446 47.8 Plus
GstD11-PB 243 CG17639-PB 27..207 6..187 446 47.8 Plus
GstE7-PA 223 CG17531-PA 1..215 1..213 376 38.5 Plus
GstE8-PB 222 CG17533-PB 1..200 1..199 363 39.6 Plus
GstE8-PA 222 CG17533-PA 1..200 1..199 363 39.6 Plus
GstE6-PA 222 CG17530-PA 1..208 1..206 363 36.5 Plus
GstE3-PA 220 CG17524-PA 1..216 1..221 349 36.3 Plus
GstE12-PC 223 CG16936-PC 6..214 6..212 345 37.4 Plus
GstE12-PB 223 CG16936-PB 6..214 6..212 345 37.4 Plus
GstE12-PD 223 CG16936-PD 6..214 6..212 345 37.4 Plus
GstE12-PA 223 CG16936-PA 6..214 6..212 345 37.4 Plus
GstE10-PB 240 CG17522-PB 1..212 1..213 344 37.8 Plus
GstE10-PA 240 CG17522-PA 1..212 1..213 344 37.8 Plus
GstE1-PA 224 CG5164-PA 8..215 6..212 343 38.8 Plus
GstE2-PA 221 CG17523-PA 5..208 4..206 340 37.6 Plus
GstE11-PB 225 CG5224-PB 7..225 6..221 332 35.6 Plus
GstE11-PA 225 CG5224-PA 7..225 6..221 332 35.6 Plus
GstE5-PA 222 CG17527-PA 1..214 1..212 328 34.6 Plus
GstE9-PA 221 CG17534-PA 1..216 1..218 321 34.2 Plus
GstE4-PA 222 CG17525-PA 1..200 1..199 320 34.2 Plus
GstE14-PA 232 CG4688-PA 4..215 2..214 277 30.6 Plus
gfzf-PD 234 CG33546-PD 1..212 4..213 275 33.9 Plus
gfzf-PE 1045 CG33546-PE 812..1023 4..213 275 33.9 Plus
gfzf-PB 1045 CG33546-PB 812..1023 4..213 275 33.9 Plus
GstE13-PB 226 CG11784-PB 6..201 6..199 272 34 Plus
GstE13-PA 226 CG11784-PA 6..201 6..199 272 34 Plus
GstT3-PC 228 CG1702-PC 12..199 11..188 152 26.5 Plus
GstT3-PA 228 CG1702-PA 12..199 11..188 152 26.5 Plus
GstT3-PB 268 CG1702-PB 52..239 11..188 152 26.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22354-PA 208 GI22354-PA 1..207 4..211 662 61.1 Plus
Dmoj\GI23195-PA 216 GI23195-PA 1..216 4..224 656 56.1 Plus
Dmoj\GI24379-PA 209 GI24379-PA 2..208 4..211 648 59.1 Plus
Dmoj\GI23194-PA 213 GI23194-PA 1..211 4..215 646 56.6 Plus
Dmoj\GI23193-PA 214 GI23193-PA 1..202 4..206 645 60.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27300-PA 217 GL27300-PA 1..216 4..219 773 67.3 Plus
Dper\GL27302-PA 215 GL27302-PA 1..209 4..213 719 63.8 Plus
Dper\GL27301-PA 213 GL27301-PA 1..213 4..216 704 61.7 Plus
Dper\GL27303-PA 213 GL27303-PA 1..209 4..212 673 58.9 Plus
Dper\GL27184-PA 209 GL27184-PA 3..208 5..211 648 58.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18009-PA 219 GA18009-PA 1..217 4..222 769 66.2 Plus
Dpse\GA27028-PA 215 GA27028-PA 1..209 4..213 715 63.3 Plus
Dpse\GA27027-PA 213 GA27027-PA 1..213 4..216 701 61.2 Plus
Dpse\GA18171-PA 213 GA18171-PA 1..209 4..212 672 58.9 Plus
Dpse\GA10031-PA 209 GA10031-PA 3..208 5..211 648 58.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24020-PA 218 GM24020-PA 1..216 1..216 1049 90.3 Plus
Dsec\GM24018-PA 215 GM24018-PA 1..213 4..217 717 63.1 Plus
Dsec\GM24017-PA 215 GM24017-PA 1..215 4..218 676 58.3 Plus
Dsec\GM24021-PA 212 GM24021-PA 1..209 4..213 661 57.6 Plus
Dsec\GstD1-PA 209 GM26019-PA 3..209 5..212 649 58.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:21:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18820-PA 223 GD18820-PA 1..223 1..224 1081 90.6 Plus
Dsim\GD18819-PA 215 GD18819-PA 1..209 4..213 773 68.6 Plus
Dsim\GD18815-PA 215 GD18815-PA 1..213 4..217 741 65.4 Plus
Dsim\GD18817-PA 215 GD18817-PA 1..213 4..217 731 64 Plus
Dsim\GD18818-PA 216 GD18818-PA 1..216 4..219 713 62.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22854-PA 213 GJ22854-PA 1..205 4..209 654 60.2 Plus
Dvir\GJ24385-PA 209 GJ24385-PA 3..209 5..212 644 57.7 Plus
Dvir\GJ22855-PA 200 GJ22855-PA 1..200 20..224 641 60.5 Plus
Dvir\GJ22856-PA 200 GJ22856-PA 1..200 20..224 641 60 Plus
Dvir\GJ14446-PA 213 GJ14446-PA 1..212 4..216 641 55.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11202-PA 218 GK11202-PA 1..218 1..219 705 62.6 Plus
Dwil\GK11874-PA 219 GK11874-PA 1..216 4..220 692 60.4 Plus
Dwil\GK11875-PA 214 GK11875-PA 1..214 4..218 691 61.9 Plus
Dwil\GK11204-PA 209 GK11204-PA 3..209 5..212 669 60.1 Plus
Dwil\GK11871-PA 215 GK11871-PA 1..215 4..220 669 59 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26180-PA 224 GE26180-PA 1..224 1..224 1051 87.1 Plus
Dyak\GE26179-PA 215 GE26179-PA 1..209 4..213 778 69 Plus
Dyak\GE26175-PA 215 GE26175-PA 1..213 4..217 755 66.4 Plus
Dyak\GE26173-PA 215 GE26173-PA 1..215 4..218 742 64.8 Plus
Dyak\GE26178-PA 216 GE26178-PA 1..216 4..220 723 62.2 Plus