Clone IP02631 Report

Search the DGRC for IP02631

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:26
Well:31
Vector:pOT2
Associated Gene/TranscriptObp28a-RA
Protein status:IP02631.pep: gold
Preliminary Size:494
Sequenced Size:611

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6641 2005-01-01 Successful iPCR screen
Pbprp5 2008-04-29 Release 5.5 accounting
Pbprp5 2008-08-15 Release 5.9 accounting
Pbprp5 2008-12-18 5.12 accounting

Clone Sequence Records

IP02631.complete Sequence

611 bp (611 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023268

> IP02631.complete
CACCGACCTAGCATCATGCAGTCTACTCCGTTCAGACACACCGACCTAGC
ATCATGCAGTCTACTCCAATCATTCTGGTGGCAATCGTCCTTCTCGGCGC
CGCACTGGTGCGAGCCTTTGACGAGAAGGAGGCCCTGGCCAAGCTGATGG
AGTCAGCCGAGAGCTGCATGCCGGAAGTGGGGGCCACCGATGCCGATCTG
CAGGAAATGGTCAAGAAGCAGCCAGCCAGCACATATGCCGGCAAGTGCCT
GCGCGCCTGCGTGATGAAGAACATCGGAATTCTGGACGCCAACGGAAAAC
TGGACACGGAGGCAGGTCACGAGAAGGCCAAGCAGTACACGGGCAACGAT
CCGGCCAAGCTAAAGATTGCCCTGGAGATCGGCGACACCTGTGCCGCCAT
CACTGTGCCGGATGATCACTGCGAGGCCGCCGAAGCCTATGGCACTTGCT
TCAGGGGCGAGGCCAAGAAACATGGACTCTTGTAATCATTGATGCAGCGC
TACCCACCTGGACACGCCGATAAAGTTACCTGGACCACCACACTTGTATC
TATAAGTTTTGAATAATCGAGGTCGAGTAAAATAAATGCATTAAAAAAAA
AAAAAAAAAAA

IP02631.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:04:39
Subject Length Description Subject Range Query Range Score Percent Strand
Pbprp5-RA 576 Pbprp5-RA 5..576 27..598 2860 100 Plus
Pbprp5-RA 576 Pbprp5-RA 17..45 1..29 145 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 7495856..7496421 592..27 2815 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:35:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7496785..7497356 598..27 2860 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7496785..7497356 598..27 2860 100 Minus
2L 23513712 2L 7497316..7497344 29..1 145 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:39:49 has no hits.

IP02631.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:40:33 Download gff for IP02631.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 7495856..7496424 20..592 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:18:14 Download gff for IP02631.complete
Subject Subject Range Query Range Percent Splice Strand
Pbprp5-RA 1..432 54..485 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:46:40 Download gff for IP02631.complete
Subject Subject Range Query Range Percent Splice Strand
Pbprp5-RA 1..432 54..485 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:57:48 Download gff for IP02631.complete
Subject Subject Range Query Range Percent Splice Strand
Obp28a-RA 1..432 54..485 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:38:55 Download gff for IP02631.complete
Subject Subject Range Query Range Percent Splice Strand
Pbprp5-RA 1..432 54..485 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:17:27 Download gff for IP02631.complete
Subject Subject Range Query Range Percent Splice Strand
Obp28a-RA 1..432 54..485 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:22:21 Download gff for IP02631.complete
Subject Subject Range Query Range Percent Splice Strand
Pbprp5-RA 2..570 25..592 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:46:40 Download gff for IP02631.complete
Subject Subject Range Query Range Percent Splice Strand
Pbprp5-RA 2..570 25..592 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:57:48 Download gff for IP02631.complete
Subject Subject Range Query Range Percent Splice Strand
Obp28a-RA 2..575 20..592 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:38:55 Download gff for IP02631.complete
Subject Subject Range Query Range Percent Splice Strand
Pbprp5-RA 2..570 25..592 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:17:27 Download gff for IP02631.complete
Subject Subject Range Query Range Percent Splice Strand
Obp28a-RA 2..575 20..592 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:40:33 Download gff for IP02631.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7496791..7497359 20..592 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:40:33 Download gff for IP02631.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7496791..7497359 20..592 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:40:33 Download gff for IP02631.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7496791..7497359 20..592 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:57:48 Download gff for IP02631.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7496791..7497359 20..592 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:11:21 Download gff for IP02631.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7496791..7497359 20..592 99   Minus

IP02631.hyp Sequence

Translation from 20 to 484

> IP02631.hyp
SSVQTHRPSIMQSTPIILVAIVLLGAALVRAFDEKEALAKLMESAESCMP
EVGATDADLQEMVKKQPASTYAGKCLRACVMKNIGILDANGKLDTEAGHE
KAKQYTGNDPAKLKIALEIGDTCAAITVPDDHCEAAEAYGTCFRGEAKKH
GLL*

IP02631.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
Obp28a-PA 143 CG6641-PA 1..143 11..153 733 100 Plus
Obp19d-PB 150 CG1668-PB 4..145 10..152 245 37.2 Plus
Obp19d-PA 150 CG1668-PA 4..145 10..152 245 37.2 Plus

IP02631.pep Sequence

Translation from 53 to 484

> IP02631.pep
MQSTPIILVAIVLLGAALVRAFDEKEALAKLMESAESCMPEVGATDADLQ
EMVKKQPASTYAGKCLRACVMKNIGILDANGKLDTEAGHEKAKQYTGNDP
AKLKIALEIGDTCAAITVPDDHCEAAEAYGTCFRGEAKKHGLL*

IP02631.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22744-PA 143 GF22744-PA 1..143 1..143 548 69.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23526-PA 143 GG23526-PA 1..143 1..143 675 89.5 Plus
Dere\GG19289-PA 150 GG19289-PA 36..145 33..142 198 39.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:05:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10975-PA 143 GH10975-PA 1..142 1..142 487 64.1 Plus
Dgri\GH17930-PA 148 GH17930-PA 2..143 3..142 260 40.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:08
Subject Length Description Subject Range Query Range Score Percent Strand
Obp28a-PA 143 CG6641-PA 1..143 1..143 733 100 Plus
Obp19d-PB 150 CG1668-PB 8..145 4..142 244 38.3 Plus
Obp19d-PA 150 CG1668-PA 8..145 4..142 244 38.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:05:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17488-PA 143 GI17488-PA 22..143 22..143 453 69.7 Plus
Dmoj\GI16309-PA 145 GI16309-PA 31..142 31..142 212 42.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26164-PA 143 GL26164-PA 8..143 8..143 580 78.7 Plus
Dper\GL26842-PA 149 GL26842-PA 34..143 33..142 237 43.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp28a-PA 143 GA19746-PA 8..143 8..143 580 78.7 Plus
Dpse\Obp19d-PA 151 GA14088-PA 4..145 8..142 239 38.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13537-PA 143 GM13537-PA 1..143 1..143 687 91.6 Plus
Dsec\GM23031-PA 150 GM23031-PA 36..145 33..142 216 41.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp28a-PA 112 GD22489-PA 1..112 32..143 528 87.5 Plus
Dsim\Obp19d-PA 150 GD17490-PA 36..145 33..142 211 40.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:05:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp28a-PA 143 GJ15099-PA 19..143 19..143 470 69.6 Plus
Dvir\Obp19d-PA 148 GJ15645-PA 34..143 33..142 234 43.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:05:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15340-PA 142 GK15340-PA 18..142 19..143 523 76 Plus
Dwil\GK20147-PA 143 GK20147-PA 29..138 33..142 223 40.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18353-PA 143 GE18353-PA 1..143 1..143 666 85.3 Plus
Dyak\GE17881-PA 150 GE17881-PA 36..145 33..142 218 41.8 Plus