Clone IP02636 Report

Search the DGRC for IP02636

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:26
Well:36
Vector:pOT2
Associated Gene/Transcripta10-RA
Protein status:IP02636.pep: gold
Preliminary Size:568
Sequenced Size:587

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6642 2005-01-01 Successful iPCR screen
a10 2008-04-29 Release 5.5 accounting
a10 2008-08-15 Release 5.9 accounting
a10 2008-12-18 5.12 accounting

Clone Sequence Records

IP02636.complete Sequence

587 bp (587 high quality bases) assembled on 2006-05-24

GenBank Submission: BT025814

> IP02636.complete
TCGATTCGAAAATGGGACAGCCCGGTTTCCGTCGTGCCATTGGGCACGTT
TCGTTGGTGGTGGCACTGATGTGCACCACCTGTTTCCAAGTGGAAGGACT
ACCCCATCCGCCGGCCACGTCGCCGTCACCAATGATGGAAAGAATGGTGG
AGCAGGCCTACGACGATAAGTTCGACAACGTCGATCTGGACGAGATCCTT
AACCAAGAGCGACTGTTGATCAACTACATAAAGTGCCTGGAGGGCACAGG
TCCTTGCACTCCCGATGCCAAGATGTTGAAGGAGATCCTGCCCGACGCCA
TCCAAACCGATTGCACCAAGTGCACGGAGAAGCAGCGGTATGGTGCTGAA
AAGGTGACCCGTCATCTCATCGACAACCGACCCACCGACTGGGAGCGTCT
GGAAAAGATCTACGATCCCGAGGGAACCTACCGCATCAAATACCAGGAGA
TGAAGTCCAAGGCCAATGAGGAGCCATAATCAATCTCTATTTTACGTCGT
TTTTAACTTAAGTGATTTTATGTTGCTTTAATTAACGAATAAACTGCAGA
GAAGCTTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP02636.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
a10-RA 696 a10-RA 113..672 1..560 2800 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:10:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17012894..17013175 282..1 1365 98.9 Minus
chr3L 24539361 chr3L 17012567..17012842 557..282 1350 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:35:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17023451..17023732 282..1 1410 100 Minus
3L 28110227 3L 17023121..17023399 560..282 1395 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17016551..17016832 282..1 1410 100 Minus
3L 28103327 3L 17016221..17016499 560..282 1395 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:10:42 has no hits.

IP02636.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:11:21 Download gff for IP02636.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17012566..17012841 283..558 98 <- Minus
chr3L 17012894..17013175 1..282 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:18:14 Download gff for IP02636.complete
Subject Subject Range Query Range Percent Splice Strand
a10-RA 1..468 12..479 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:30:02 Download gff for IP02636.complete
Subject Subject Range Query Range Percent Splice Strand
a10-RA 1..468 12..479 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:45:10 Download gff for IP02636.complete
Subject Subject Range Query Range Percent Splice Strand
a10-RA 1..468 12..479 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:00:36 Download gff for IP02636.complete
Subject Subject Range Query Range Percent Splice Strand
a10-RA 1..468 12..479 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:12:54 Download gff for IP02636.complete
Subject Subject Range Query Range Percent Splice Strand
a10-RA 1..468 12..479 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:01:27 Download gff for IP02636.complete
Subject Subject Range Query Range Percent Splice Strand
a10-RA 10..567 1..558 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:30:02 Download gff for IP02636.complete
Subject Subject Range Query Range Percent Splice Strand
a10-RA 10..567 1..558 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:45:10 Download gff for IP02636.complete
Subject Subject Range Query Range Percent Splice Strand
a10-RA 10..567 1..558 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:00:37 Download gff for IP02636.complete
Subject Subject Range Query Range Percent Splice Strand
a10-RA 10..567 1..558 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:12:54 Download gff for IP02636.complete
Subject Subject Range Query Range Percent Splice Strand
a10-RA 10..567 1..558 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:11:21 Download gff for IP02636.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17023123..17023398 283..558 100 <- Minus
3L 17023451..17023732 1..282 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:11:21 Download gff for IP02636.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17023123..17023398 283..558 100 <- Minus
3L 17023451..17023732 1..282 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:11:21 Download gff for IP02636.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17023123..17023398 283..558 100 <- Minus
3L 17023451..17023732 1..282 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:45:10 Download gff for IP02636.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17016223..17016498 283..558 100 <- Minus
arm_3L 17016551..17016832 1..282 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:55:50 Download gff for IP02636.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17016551..17016832 1..282 100   Minus
3L 17016223..17016498 283..558 100 <- Minus

IP02636.hyp Sequence

Translation from 2 to 478

> IP02636.hyp
DSKMGQPGFRRAIGHVSLVVALMCTTCFQVEGLPHPPATSPSPMMERMVE
QAYDDKFDNVDLDEILNQERLLINYIKCLEGTGPCTPDAKMLKEILPDAI
QTDCTKCTEKQRYGAEKVTRHLIDNRPTDWERLEKIYDPEGTYRIKYQEM
KSKANEEP*

IP02636.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:51:52
Subject Length Description Subject Range Query Range Score Percent Strand
a10-PA 155 CG6642-PA 1..155 4..158 837 100 Plus
PebIII-PC 126 CG11390-PC 18..116 50..148 290 48.5 Plus
PebIII-PB 126 CG11390-PB 18..116 50..148 290 48.5 Plus
PebIII-PA 126 CG11390-PA 18..116 50..148 290 48.5 Plus
Phk-3-PC 121 CG9358-PC 21..119 50..148 270 46.5 Plus

IP02636.pep Sequence

Translation from 11 to 478

> IP02636.pep
MGQPGFRRAIGHVSLVVALMCTTCFQVEGLPHPPATSPSPMMERMVEQAY
DDKFDNVDLDEILNQERLLINYIKCLEGTGPCTPDAKMLKEILPDAIQTD
CTKCTEKQRYGAEKVTRHLIDNRPTDWERLEKIYDPEGTYRIKYQEMKSK
ANEEP*

IP02636.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12892-PA 126 GF12892-PA 17..116 46..145 288 49 Plus
Dana\GF11516-PA 127 GF11516-PA 22..119 47..144 276 49 Plus
Dana\GF20186-PA 965 GF20186-PA 904..961 91..148 254 79.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15834-PA 155 GG15834-PA 1..155 1..155 760 96.1 Plus
Dere\GG22923-PA 126 GG22923-PA 21..116 50..145 287 52.1 Plus
Dere\GG19868-PA 121 GG19868-PA 21..119 47..145 285 49.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12519-PA 132 GH12519-PA 14..118 49..154 466 82.1 Plus
Dgri\GH21706-PA 127 GH21706-PA 19..123 47..151 300 50.5 Plus
Dgri\GH22042-PA 122 GH22042-PA 21..120 47..146 277 48 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
a10-PA 155 CG6642-PA 1..155 1..155 837 100 Plus
EbpIII-PC 126 CG11390-PC 18..116 47..145 290 48.5 Plus
EbpIII-PB 126 CG11390-PB 18..116 47..145 290 48.5 Plus
EbpIII-PA 126 CG11390-PA 18..116 47..145 290 48.5 Plus
Phk-3-PC 121 CG9358-PC 21..119 47..145 270 46.5 Plus
Phk-3-PB 121 CG9358-PB 21..119 47..145 270 46.5 Plus
Phk-3-PA 121 CG9358-PA 21..119 47..145 270 46.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:52:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14872-PA 169 GI14872-PA 26..155 27..155 485 70.2 Plus
Dmoj\GI18859-PA 126 GI18859-PA 17..122 46..151 295 49.1 Plus
Dmoj\GI19129-PA 126 GI19129-PA 22..121 47..146 274 47 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:52:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15312-PA 149 GL15312-PA 9..144 6..152 540 71.4 Plus
Dper\GL15311-PA 68 GL15311-PA 1..63 88..152 289 84.6 Plus
Dper\GL11652-PA 126 GL11652-PA 17..122 46..151 289 47.2 Plus
Dper\GL10889-PA 125 GL10889-PA 23..123 50..150 269 47.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19747-PA 149 GA19747-PA 9..144 6..152 540 71.4 Plus
Dpse\GA10970-PA 126 GA10970-PA 17..122 46..151 289 47.2 Plus
Dpse\GA21727-PA 125 GA21727-PA 23..123 50..150 269 47.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24353-PA 155 GM24353-PA 1..155 1..155 821 98.1 Plus
Dsec\GM18290-PA 126 GM18290-PA 18..116 47..145 280 49.5 Plus
Dsec\GM11771-PA 121 GM11771-PA 21..119 47..145 273 46.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12430-PA 155 GD12430-PA 1..155 1..155 825 98.7 Plus
Dsim\GD24902-PA 121 GD24902-PA 21..119 47..145 284 48.5 Plus
Dsim\GD11826-PA 126 GD11826-PA 18..116 47..145 281 49.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19536-PA 163 GJ19536-PA 25..143 32..149 472 72.7 Plus
Dvir\GJ20447-PA 126 GJ20447-PA 17..122 46..151 301 50.9 Plus
Dvir\GJ22262-PA 125 GJ22262-PA 22..124 47..149 285 49.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24936-PA 171 GK24936-PA 51..155 50..154 485 84.8 Plus
Dwil\GK19506-PA 127 GK19506-PA 22..126 47..151 278 46.7 Plus
Dwil\GK21931-PA 127 GK21931-PA 16..116 45..145 273 46.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22174-PA 155 GE22174-PA 1..155 1..155 801 94.2 Plus
Dyak\PebIII-PA 126 GE14360-PA 18..116 47..145 287 49.5 Plus
Dyak\Phk-3-PA 121 GE11392-PA 21..118 47..144 285 51 Plus