Clone IP02686 Report

Search the DGRC for IP02686

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:26
Well:86
Vector:pOT2
Associated Gene/TranscriptAttD-RA
Protein status:IP02686.pep: gold
Preliminary Size:744
Sequenced Size:777

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7629 2005-01-01 Successful iPCR screen
AttD 2008-04-29 Release 5.5 accounting
AttD 2008-08-15 Release 5.9 accounting
AttD 2008-12-18 5.12 accounting

Clone Sequence Records

IP02686.complete Sequence

777 bp (777 high quality bases) assembled on 2006-01-20

GenBank Submission: BT024425

> IP02686.complete
CAAGCAGAAAGACGAAATCAAAGAATTATATAAGATGGAATGTCAGGCTT
CAGGAAACCCAAAGAGCGGAGCGGCAACCGCCCAATGCGGAGTAAGGGTC
GGTGATGATCTTGCCAATGCTCGAGCCGGAGTATTCGCCTCCACTCCAGG
CGCTGGGGGTCCGGTCACCAAGGGAGTTTATGGAGCGGTCAACGCCAATG
GTCATGCACTCTCACTGCAGCATGGCCACATCGAGGGCGTGGGCAGCACT
ACCACTGCCGCAGCCCAAGCCAATCTCTTCCAGAGCAATAACGCCGCTCT
GAATGCCACTGCATTTCACAGTCATAGCCGATCGCACGATCAGTTTGGCG
GAGGACTCAATTTGCAAACTGGAACGGGTCACCAGGCGGCAGTGGGGGTC
ACTAGGGTTCCTCAGTTCGGCATGACCGCCGTCCAGGCTTCTGGCACAGC
AAATCTGTATACCTCTCCAAGTGGCAATCTCAACCTCAACGCCACCGGAA
GTGCCAATCATCACCTCAGGGGACCGATGCGCGGCAAGTCCGATTTCGGC
ACCGGAGTTAACTTGCGATATAATTTTTAAATCCTTTATAGTTTTATTGA
AACTATTCATAGTCACATTTAGTACTTGCACGTAGCCAAGAAAAGAAACA
AGTGCCGTATTTATATGCATTATATCGAAGATTAAATAAACCATGCTATT
AAAAGCGCTTTCTACTTGGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAA

IP02686.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:21:44
Subject Length Description Subject Range Query Range Score Percent Strand
AttD-RA 773 AttD-RA 45..766 1..722 3610 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13449926..13450450 196..720 2595 99.6 Plus
chr3R 27901430 chr3R 13449654..13449848 1..195 975 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:35:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17625562..17626088 196..722 2635 100 Plus
3R 32079331 3R 17625290..17625484 1..195 975 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:14:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17366393..17366919 196..722 2635 100 Plus
3R 31820162 3R 17366121..17366315 1..195 975 100 Plus
Blast to na_te.dros performed 2019-03-16 15:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 5558..5615 717..657 109 67.2 Minus

IP02686.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:21:26 Download gff for IP02686.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13449654..13449848 1..195 100 -> Plus
chr3R 13449926..13450450 196..720 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:18:22 Download gff for IP02686.complete
Subject Subject Range Query Range Percent Splice Strand
AttD-RA 1..546 35..580 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:38:19 Download gff for IP02686.complete
Subject Subject Range Query Range Percent Splice Strand
AttD-RA 1..546 35..580 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:43:44 Download gff for IP02686.complete
Subject Subject Range Query Range Percent Splice Strand
AttD-RA 1..546 35..580 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:13:20 Download gff for IP02686.complete
Subject Subject Range Query Range Percent Splice Strand
AttD-RA 1..546 35..580 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:45:01 Download gff for IP02686.complete
Subject Subject Range Query Range Percent Splice Strand
AttD-RA 1..546 35..580 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:10:10 Download gff for IP02686.complete
Subject Subject Range Query Range Percent Splice Strand
AttD-RA 23..742 1..720 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:38:18 Download gff for IP02686.complete
Subject Subject Range Query Range Percent Splice Strand
AttD-RA 23..742 1..720 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:43:44 Download gff for IP02686.complete
Subject Subject Range Query Range Percent Splice Strand
AttD-RA 23..742 1..720 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:13:20 Download gff for IP02686.complete
Subject Subject Range Query Range Percent Splice Strand
AttD-RA 23..742 1..720 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:45:01 Download gff for IP02686.complete
Subject Subject Range Query Range Percent Splice Strand
AttD-RA 23..742 1..720 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:21:26 Download gff for IP02686.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17625290..17625484 1..195 100 -> Plus
3R 17625562..17626086 196..720 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:21:26 Download gff for IP02686.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17625290..17625484 1..195 100 -> Plus
3R 17625562..17626086 196..720 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:21:26 Download gff for IP02686.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17625290..17625484 1..195 100 -> Plus
3R 17625562..17626086 196..720 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:43:44 Download gff for IP02686.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13451012..13451206 1..195 100 -> Plus
arm_3R 13451284..13451808 196..720 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:01:17 Download gff for IP02686.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17366393..17366917 196..720 100   Plus
3R 17366121..17366315 1..195 100 -> Plus

IP02686.hyp Sequence

Translation from 0 to 579

> IP02686.hyp
KQKDEIKELYKMECQASGNPKSGAATAQCGVRVGDDLANARAGVFASTPG
AGGPVTKGVYGAVNANGHALSLQHGHIEGVGSTTTAAAQANLFQSNNAAL
NATAFHSHSRSHDQFGGGLNLQTGTGHQAAVGVTRVPQFGMTAVQASGTA
NLYTSPSGNLNLNATGSANHHLRGPMRGKSDFGTGVNLRYNF*

IP02686.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
AttD-PA 181 CG7629-PA 1..181 12..192 947 100 Plus
AttA-PA 221 CG10146-PA 39..220 17..192 196 33.3 Plus
AttB-PB 218 CG18372-PB 36..217 17..192 194 32.8 Plus
AttB-PA 218 CG18372-PA 36..217 17..192 194 32.8 Plus
AttC-PB 241 CG4740-PB 56..240 17..192 175 30.1 Plus

IP02686.pep Sequence

Translation from 34 to 579

> IP02686.pep
MECQASGNPKSGAATAQCGVRVGDDLANARAGVFASTPGAGGPVTKGVYG
AVNANGHALSLQHGHIEGVGSTTTAAAQANLFQSNNAALNATAFHSHSRS
HDQFGGGLNLQTGTGHQAAVGVTRVPQFGMTAVQASGTANLYTSPSGNLN
LNATGSANHHLRGPMRGKSDFGTGVNLRYNF*

IP02686.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:22:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17819-PA 181 GF17819-PA 1..181 1..181 732 76.2 Plus
Dana\GF13689-PA 244 GF13689-PA 101..243 43..181 160 33.3 Plus
Dana\GF11339-PA 235 GF11339-PA 55..234 8..181 159 33.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:22:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22395-PA 181 GG22395-PA 1..181 1..181 884 93.9 Plus
Dere\GG20378-PA 222 GG20378-PA 65..221 33..181 156 32.9 Plus
Dere\GG20477-PA 224 GG20477-PA 42..223 6..181 143 32.8 Plus
Dere\GG20476-PA 224 GG20476-PA 42..223 6..181 142 32.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18099-PA 181 GH18099-PA 1..181 1..181 644 68 Plus
Dgri\GH23752-PA 243 GH23752-PA 96..243 38..181 160 30.9 Plus
Dgri\GH20752-PA 235 GH20752-PA 83..234 34..181 158 33.3 Plus
Dgri\GH21628-PA 243 GH21628-PA 109..243 51..181 141 30.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
AttD-PA 181 CG7629-PA 1..181 1..181 947 100 Plus
AttA-PA 221 CG10146-PA 39..220 6..181 196 33.3 Plus
AttB-PB 218 CG18372-PB 36..217 6..181 194 32.8 Plus
AttB-PA 218 CG18372-PA 36..217 6..181 194 32.8 Plus
AttC-PB 241 CG4740-PB 56..240 6..181 175 30.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24598-PA 181 GI24598-PA 1..181 1..181 597 61.9 Plus
Dmoj\GI20837-PA 237 GI20837-PA 55..236 5..181 180 33.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21518-PA 181 GL21518-PA 1..181 1..181 694 72.4 Plus
Dper\GL23282-PA 234 GL23282-PA 74..232 28..181 161 34.4 Plus
Dper\GL23315-PA 232 GL23315-PA 72..230 28..181 158 34.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20491-PA 181 GA20491-PA 1..181 1..181 703 72.9 Plus
Dpse\GA27220-PA 232 GA27220-PA 51..230 8..181 164 33.7 Plus
Dpse\GA27207-PA 234 GA27207-PA 53..232 8..181 162 33.7 Plus
Dpse\GA10109-PA 236 GA10109-PA 70..234 22..181 158 33.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15251-PA 181 GM15251-PA 1..181 1..181 905 97.8 Plus
Dsec\GM21567-PA 218 GM21567-PA 38..217 8..181 154 33.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19176-PA 181 GD19176-PA 1..181 1..181 889 95 Plus
Dsim\AttB-PA 218 GD11073-PA 38..217 8..181 162 34.3 Plus
Dsim\AttA-PA 218 GD11072-PA 38..217 8..181 157 33.7 Plus
Dsim\AttC-PA 222 GD10964-PA 79..221 43..181 147 31.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22662-PA 181 GJ22662-PA 1..181 1..181 657 68.5 Plus
Dvir\GJ20572-PA 234 GJ20572-PA 70..233 22..181 170 32.7 Plus
Dvir\GJ20571-PA 234 GJ20571-PA 70..233 22..181 169 32.7 Plus
Dvir\GJ21173-PA 235 GJ21173-PA 89..230 40..177 158 32.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12085-PA 182 GK12085-PA 1..182 1..181 584 62.6 Plus
Dwil\GK19632-PA 234 GK19632-PA 55..233 8..181 177 32.8 Plus
Dwil\GK17822-PA 247 GK17822-PA 60..246 6..181 171 32.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\AttD-PA 181 GE25488-PA 1..181 1..181 874 93.4 Plus
Dyak\GE12538-PA 222 GE12538-PA 79..221 43..181 148 31.9 Plus
Dyak\AttA-PA 224 GE13606-PA 44..223 8..181 142 32.6 Plus
Dyak\GE13607-PA 224 GE13607-PA 44..223 8..181 142 32.6 Plus