BDGP Sequence Production Resources |
Search the DGRC for IP02710
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 27 |
Well: | 10 |
Vector: | pOT2 |
Associated Gene/Transcript | Ssb-c31a-RA |
Protein status: | IP02710.pep: gold |
Preliminary Size: | 512 |
Sequenced Size: | 525 |
Gene | Date | Evidence |
---|---|---|
CG8396 | 2005-01-01 | Successful iPCR screen |
Ssb-c31a | 2008-04-29 | Release 5.5 accounting |
Ssb-c31a | 2008-08-15 | Release 5.9 accounting |
Ssb-c31a | 2008-12-18 | 5.12 accounting |
525 bp (525 high quality bases) assembled on 2005-03-01
GenBank Submission: BT023261
> IP02710.complete TTGCGCGAATATTCACGAATTTTTTGACAATTTGCGTTTTGTTTCTTCTG TTTTACGGAAATTCTATAAAAATGCCCAAAACAAAGAAGAAGGATTCGTC CTCAGATAGCGATAGCGGTCCAGATGATCGTATCAAGCCGGCAAGCAAGA AGGCGAAGGAATCTGATGCTCCAAATTCAGATCCAAAAGATTCGGGCGAA AATGGTGCTACATCTTGGACCCTGGAAGGACTTCGCCAGGTGCGAATCAA CGAGTTCCGCGGTCGCAAATCGGTGGACATTCGAGAGTTCTACGATAAGG GCGGCCAAATTCTTCCCGGCAAGAAGGGCATCTCCCTATCTTTAATTCAA TGGAAGAAACTCCTTGAAGTGGCCGAAGAAGTCACCCGCGCGATCGAGAA TTAATTGAAGTTCATCCACATGCCAAACTAAGTCGTAGCCATATGTACTA ACTATAGACATATCCACTGAATAAACGTTATCTTAAACACTAGTAATTGA AAATCTGTAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ssb-c31a-RA | 635 | Ssb-c31a-RA | 108..616 | 1..509 | 2545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 8210355..8210482 | 1..128 | 100 | -> | Plus |
chr2L | 8210539..8210918 | 129..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ssb-c31a-RA | 1..333 | 72..404 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ssb-c31a-RA | 1..333 | 72..404 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ssb-c31a-RA | 1..333 | 72..404 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ssb-c31a-RA | 1..333 | 72..404 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ssb-c31a-RA | 1..333 | 72..404 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ssb-c31a-RA | 13..512 | 1..500 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ssb-c31a-RA | 29..536 | 1..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ssb-c31a-RA | 29..536 | 1..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ssb-c31a-RA | 13..512 | 1..500 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ssb-c31a-RA | 29..536 | 1..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8211375..8211502 | 1..128 | 100 | -> | Plus |
2L | 8211559..8211938 | 129..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8211375..8211502 | 1..128 | 100 | -> | Plus |
2L | 8211559..8211938 | 129..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8211375..8211502 | 1..128 | 100 | -> | Plus |
2L | 8211559..8211938 | 129..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 8211375..8211502 | 1..128 | 100 | -> | Plus |
arm_2L | 8211559..8211938 | 129..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8211559..8211938 | 129..508 | 100 | Plus | |
2L | 8211375..8211502 | 1..128 | 100 | -> | Plus |
Translation from 2 to 403
> IP02710.hyp ARIFTNFLTICVLFLLFYGNSIKMPKTKKKDSSSDSDSGPDDRIKPASKK AKESDAPNSDPKDSGENGATSWTLEGLRQVRINEFRGRKSVDIREFYDKG GQILPGKKGISLSLIQWKKLLEVAEEVTRAIEN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ssb-c31a-PA | 110 | CG8396-PA | 1..110 | 24..133 | 564 | 100 | Plus |
Translation from 71 to 403
> IP02710.pep MPKTKKKDSSSDSDSGPDDRIKPASKKAKESDAPNSDPKDSGENGATSWT LEGLRQVRINEFRGRKSVDIREFYDKGGQILPGKKGISLSLIQWKKLLEV AEEVTRAIEN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15272-PA | 111 | GF15272-PA | 18..111 | 16..110 | 283 | 63.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10524-PA | 110 | GG10524-PA | 1..110 | 1..110 | 458 | 82.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11512-PA | 119 | GH11512-PA | 1..118 | 1..109 | 304 | 63.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ssb-c31a-PA | 110 | CG8396-PA | 1..110 | 1..110 | 564 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17008-PA | 113 | GI17008-PA | 1..112 | 1..109 | 294 | 67.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18728-PA | 117 | GL18728-PA | 1..117 | 1..110 | 304 | 67.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21044-PA | 117 | GA21044-PA | 1..117 | 1..110 | 304 | 67.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16854-PA | 110 | GM16854-PA | 1..110 | 1..110 | 539 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23514-PA | 110 | GD23514-PA | 1..110 | 1..110 | 539 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24334-PA | 111 | GJ24334-PA | 1..110 | 1..109 | 303 | 67.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15158-PA | 113 | GK15158-PA | 1..112 | 1..109 | 310 | 65.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18744-PA | 110 | GE18744-PA | 1..110 | 1..110 | 455 | 81.8 | Plus |