Clone IP02710 Report

Search the DGRC for IP02710

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:27
Well:10
Vector:pOT2
Associated Gene/TranscriptSsb-c31a-RA
Protein status:IP02710.pep: gold
Preliminary Size:512
Sequenced Size:525

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8396 2005-01-01 Successful iPCR screen
Ssb-c31a 2008-04-29 Release 5.5 accounting
Ssb-c31a 2008-08-15 Release 5.9 accounting
Ssb-c31a 2008-12-18 5.12 accounting

Clone Sequence Records

IP02710.complete Sequence

525 bp (525 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023261

> IP02710.complete
TTGCGCGAATATTCACGAATTTTTTGACAATTTGCGTTTTGTTTCTTCTG
TTTTACGGAAATTCTATAAAAATGCCCAAAACAAAGAAGAAGGATTCGTC
CTCAGATAGCGATAGCGGTCCAGATGATCGTATCAAGCCGGCAAGCAAGA
AGGCGAAGGAATCTGATGCTCCAAATTCAGATCCAAAAGATTCGGGCGAA
AATGGTGCTACATCTTGGACCCTGGAAGGACTTCGCCAGGTGCGAATCAA
CGAGTTCCGCGGTCGCAAATCGGTGGACATTCGAGAGTTCTACGATAAGG
GCGGCCAAATTCTTCCCGGCAAGAAGGGCATCTCCCTATCTTTAATTCAA
TGGAAGAAACTCCTTGAAGTGGCCGAAGAAGTCACCCGCGCGATCGAGAA
TTAATTGAAGTTCATCCACATGCCAAACTAAGTCGTAGCCATATGTACTA
ACTATAGACATATCCACTGAATAAACGTTATCTTAAACACTAGTAATTGA
AAATCTGTAAAAAAAAAAAAAAAAA

IP02710.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
Ssb-c31a-RA 635 Ssb-c31a-RA 108..616 1..509 2545 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:11:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8210539..8210918 129..508 1900 100 Plus
chr2L 23010047 chr2L 8210355..8210482 1..128 640 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:35:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8211559..8211939 129..509 1905 100 Plus
2L 23513712 2L 8211375..8211502 1..128 640 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:43:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8211559..8211939 129..509 1905 100 Plus
2L 23513712 2L 8211375..8211502 1..128 640 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:11:57 has no hits.

IP02710.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:12:49 Download gff for IP02710.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8210355..8210482 1..128 100 -> Plus
chr2L 8210539..8210918 129..508 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:18:26 Download gff for IP02710.complete
Subject Subject Range Query Range Percent Splice Strand
Ssb-c31a-RA 1..333 72..404 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:26:50 Download gff for IP02710.complete
Subject Subject Range Query Range Percent Splice Strand
Ssb-c31a-RA 1..333 72..404 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:45:55 Download gff for IP02710.complete
Subject Subject Range Query Range Percent Splice Strand
Ssb-c31a-RA 1..333 72..404 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:10:53 Download gff for IP02710.complete
Subject Subject Range Query Range Percent Splice Strand
Ssb-c31a-RA 1..333 72..404 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:13:35 Download gff for IP02710.complete
Subject Subject Range Query Range Percent Splice Strand
Ssb-c31a-RA 1..333 72..404 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:29:50 Download gff for IP02710.complete
Subject Subject Range Query Range Percent Splice Strand
Ssb-c31a-RA 13..512 1..500 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:26:49 Download gff for IP02710.complete
Subject Subject Range Query Range Percent Splice Strand
Ssb-c31a-RA 29..536 1..508 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:45:55 Download gff for IP02710.complete
Subject Subject Range Query Range Percent Splice Strand
Ssb-c31a-RA 29..536 1..508 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:10:53 Download gff for IP02710.complete
Subject Subject Range Query Range Percent Splice Strand
Ssb-c31a-RA 13..512 1..500 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:13:35 Download gff for IP02710.complete
Subject Subject Range Query Range Percent Splice Strand
Ssb-c31a-RA 29..536 1..508 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:49 Download gff for IP02710.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8211375..8211502 1..128 100 -> Plus
2L 8211559..8211938 129..508 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:49 Download gff for IP02710.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8211375..8211502 1..128 100 -> Plus
2L 8211559..8211938 129..508 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:49 Download gff for IP02710.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8211375..8211502 1..128 100 -> Plus
2L 8211559..8211938 129..508 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:45:55 Download gff for IP02710.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8211375..8211502 1..128 100 -> Plus
arm_2L 8211559..8211938 129..508 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:47:24 Download gff for IP02710.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8211559..8211938 129..508 100   Plus
2L 8211375..8211502 1..128 100 -> Plus

IP02710.hyp Sequence

Translation from 2 to 403

> IP02710.hyp
ARIFTNFLTICVLFLLFYGNSIKMPKTKKKDSSSDSDSGPDDRIKPASKK
AKESDAPNSDPKDSGENGATSWTLEGLRQVRINEFRGRKSVDIREFYDKG
GQILPGKKGISLSLIQWKKLLEVAEEVTRAIEN*

IP02710.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
Ssb-c31a-PA 110 CG8396-PA 1..110 24..133 564 100 Plus

IP02710.pep Sequence

Translation from 71 to 403

> IP02710.pep
MPKTKKKDSSSDSDSGPDDRIKPASKKAKESDAPNSDPKDSGENGATSWT
LEGLRQVRINEFRGRKSVDIREFYDKGGQILPGKKGISLSLIQWKKLLEV
AEEVTRAIEN*

IP02710.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:21:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15272-PA 111 GF15272-PA 18..111 16..110 283 63.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:21:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10524-PA 110 GG10524-PA 1..110 1..110 458 82.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:21:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11512-PA 119 GH11512-PA 1..118 1..109 304 63.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
Ssb-c31a-PA 110 CG8396-PA 1..110 1..110 564 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:21:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17008-PA 113 GI17008-PA 1..112 1..109 294 67.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:21:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18728-PA 117 GL18728-PA 1..117 1..110 304 67.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:21:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21044-PA 117 GA21044-PA 1..117 1..110 304 67.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:21:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16854-PA 110 GM16854-PA 1..110 1..110 539 96.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:21:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23514-PA 110 GD23514-PA 1..110 1..110 539 96.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:21:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24334-PA 111 GJ24334-PA 1..110 1..109 303 67.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:21:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15158-PA 113 GK15158-PA 1..112 1..109 310 65.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:21:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18744-PA 110 GE18744-PA 1..110 1..110 455 81.8 Plus