Clone IP02720 Report

Search the DGRC for IP02720

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:27
Well:20
Vector:pOT2
Associated Gene/Transcriptlush-RA
Protein status:IP02720.pep: gold
Preliminary Size:964
Sequenced Size:965

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8807 2005-01-01 Successful iPCR screen
lush 2008-04-29 Release 5.5 accounting
lush 2008-08-15 Release 5.9 accounting
lush 2008-12-18 5.12 accounting

Clone Sequence Records

IP02720.complete Sequence

965 bp (965 high quality bases) assembled on 2006-01-24

GenBank Submission: BT024426

> IP02720.complete
CTTGCACATCAAAGTAGTATCTCCATAATTCGACTATTGTCGTGTCATTC
AAATGGTACAAATACAACTTCCTAGTCAACTCAAATGGCGTGCGAGTGCG
TTACTTAATTATTAATCCCTGCGATTTAATTACCACCTTTCCCTGCCATC
ATGATCACCTATAAAACTCTCCTACGACATGGTTACTCAACGTATTTAGC
TTTCCGCCACCATGAAGCATTGGAAACGACGCTCTTCCGCTGTTTTCGCG
ATCGTCCTGCAAGTGCTGGTACTCCTGCTACCCGATCCTGCAGTTGCCAT
GACGATGGAGCAGTTCTTGACCTCGCTAGACATGATCCGCAGTGGCTGTG
CGCCGAAGTTTAAGCTCAAAACAGAAGATCTCGATCGGCTTCGCGTGGGT
GATTTCAACTTTCCGCCATCGCAGGATCTTATGTGCTACACAAAGTGTGT
GTCCTTGATGGCGGGCACTGTGAACAAAAAGGGGGAGTTCAACGCTCCCA
AGGCGCTGGCCCAACTTCCGCATCTGGTTCCCCCGGAAATGATGGAGATG
TCCAGGAAATCCGTTGAAGCTTGTCGGGATACGCATAAACAATTTAAGGA
ATCTTGCGAGAGGGTCTACCAGACGGCCAAGTGCTTCTCTGAAAACGCCG
ATGGGCAGTTCATGTGGCCTTAAAAATGTTTCTGGAAACTAAATTCATAC
TGGTTCATCCTTTAATGACCAATCCTTGGATGATTGCTTTATTATCTATG
TTGAAATCATAAAATAGAATTGGAATTCGTAAAACATAAATTATGACAAG
AAAGGAAGTTAGCTTCAAAAAGCCGAAGTATATACTTATATACCCTTGCA
GTAATATGATGTTGATTAAATTGAAACCAAAATTTATATATTAAAGACAA
CTTATGTATACAGAATAACATCAATTTATGATTAAAAACGAAAAAAAAAA
AAAAAAAAAAAAAAA

IP02720.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
lush-RB 940 lush-RB 1..940 1..940 4610 99.3 Plus
lush-RA 1003 lush-RA 70..994 17..941 4535 99.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19594411..19594827 433..17 2070 99.8 Minus
chr3L 24539361 chr3L 19593789..19594144 940..585 1735 99.2 Minus
chr3L 24539361 chr3L 19594201..19594356 588..433 750 98.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:35:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:08:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19605030..19605446 433..17 2025 99 Minus
3L 28110227 3L 19604407..19604763 941..585 1770 99.7 Minus
3L 28110227 3L 19604820..19604975 588..433 750 98.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19598130..19598546 433..17 2025 99 Minus
3L 28103327 3L 19597507..19597863 941..585 1770 99.7 Minus
3L 28103327 3L 19597920..19598075 588..433 750 98.7 Minus
Blast to na_te.dros performed on 2019-03-16 14:08:29 has no hits.

IP02720.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:09:34 Download gff for IP02720.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19593789..19594144 585..940 99 <- Minus
chr3L 19594205..19594355 434..584 99 <- Minus
chr3L 19594411..19594827 17..433 99 <- Minus
chr3L 19595337..19595352 1..16 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:18:30 Download gff for IP02720.complete
Subject Subject Range Query Range Percent Splice Strand
lush-RA 1..462 212..673 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:36:25 Download gff for IP02720.complete
Subject Subject Range Query Range Percent Splice Strand
lush-RB 1..462 212..673 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:30:26 Download gff for IP02720.complete
Subject Subject Range Query Range Percent Splice Strand
lush-RA 1..462 212..673 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:11:06 Download gff for IP02720.complete
Subject Subject Range Query Range Percent Splice Strand
lush-RA 1..462 212..673 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:23:36 Download gff for IP02720.complete
Subject Subject Range Query Range Percent Splice Strand
lush-RA 1..462 212..673 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:07:53 Download gff for IP02720.complete
Subject Subject Range Query Range Percent Splice Strand
lush-RA 30..953 17..940 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:36:25 Download gff for IP02720.complete
Subject Subject Range Query Range Percent Splice Strand
lush-RB 1..940 1..940 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:30:26 Download gff for IP02720.complete
Subject Subject Range Query Range Percent Splice Strand
lush-RB 1..940 1..940 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:11:06 Download gff for IP02720.complete
Subject Subject Range Query Range Percent Splice Strand
lush-RA 30..953 17..940 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:23:36 Download gff for IP02720.complete
Subject Subject Range Query Range Percent Splice Strand
lush-RB 1..940 1..940 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:34 Download gff for IP02720.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19604408..19604763 585..940 99 <- Minus
3L 19604824..19604974 434..584 99 <- Minus
3L 19605030..19605446 17..433 99 <- Minus
3L 19605956..19605971 1..16 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:34 Download gff for IP02720.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19604408..19604763 585..940 99 <- Minus
3L 19604824..19604974 434..584 99 <- Minus
3L 19605030..19605446 17..433 99 <- Minus
3L 19605956..19605971 1..16 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:34 Download gff for IP02720.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19604408..19604763 585..940 99 <- Minus
3L 19604824..19604974 434..584 99 <- Minus
3L 19605030..19605446 17..433 99 <- Minus
3L 19605956..19605971 1..16 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:30:26 Download gff for IP02720.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19597508..19597863 585..940 99 <- Minus
arm_3L 19597924..19598074 434..584 99 <- Minus
arm_3L 19598130..19598546 17..433 99 <- Minus
arm_3L 19599056..19599071 1..16 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:59:54 Download gff for IP02720.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19597508..19597863 585..940 99 <- Minus
3L 19597924..19598074 434..584 99 <- Minus
3L 19598130..19598546 17..433 99 <- Minus
3L 19599056..19599071 1..16 100   Minus

IP02720.hyp Sequence

Translation from 211 to 672

> IP02720.hyp
MKHWKRRSSAVFAIVLQVLVLLLPDPAVAMTMEQFLTSLDMIRSGCAPKF
KLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALA
QLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQF
MWP*

IP02720.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
lush-PB 153 CG8807-PB 1..153 1..153 810 100 Plus
lush-PA 153 CG8807-PA 1..153 1..153 810 100 Plus
Obp19a-PC 146 CG11748-PC 17..139 23..145 148 28.6 Plus

IP02720.pep Sequence

Translation from 211 to 672

> IP02720.pep
MKHWKRRSSAVFAIVLQVLVLLLPDPAVAMTMEQFLTSLDMIRSGCAPKF
KLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALA
QLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQF
MWP*

IP02720.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10723-PA 147 GF10723-PA 1..147 1..153 501 56.9 Plus
Dana\GF19415-PA 150 GF19415-PA 8..150 11..153 150 29.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13391-PA 153 GG13391-PA 1..153 1..153 731 94.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23896-PA 157 GH23896-PA 27..157 23..153 346 46.6 Plus
Dgri\GH14624-PA 157 GH14624-PA 27..157 23..153 346 46.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
lush-PB 153 CG8807-PB 1..153 1..153 810 100 Plus
lush-PA 153 CG8807-PA 1..153 1..153 810 100 Plus
Obp19a-PC 146 CG11748-PC 17..139 23..145 148 28.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13512-PA 157 GI13512-PA 33..157 29..153 337 48.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20882-PA 155 GL20882-PA 1..155 1..153 452 56.1 Plus
Dper\GL26840-PA 145 GL26840-PA 7..145 14..153 136 26.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp76a-PA 155 GA21335-PA 1..155 1..153 437 54.8 Plus
Dpse\Obp19a-PA 145 GA11172-PA 7..138 14..145 138 27.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17416-PA 153 GM17416-PA 1..153 1..153 819 99.3 Plus
Dsec\GM23029-PA 159 GM23029-PA 30..159 23..153 142 28.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp76a-PA 153 GD12267-PA 1..153 1..153 821 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp76a-PA 165 GJ11873-PA 36..165 24..153 315 41.5 Plus
Dvir\Obp19a-PA 162 GJ15643-PA 43..162 31..153 143 31.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20246-PA 151 GK20246-PA 12..151 14..153 414 49.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:19:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14740-PA 153 GE14740-PA 1..153 1..153 703 90.2 Plus
Dyak\GE22483-PA 153 GE22483-PA 1..153 1..153 703 90.2 Plus
Dyak\GE17879-PA 159 GE17879-PA 30..159 23..153 135 28.4 Plus